Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

µ/ω-TRTX-Tap1a

Mu/omega-TRTX-Tap1a, Mu/omega-theraphotoxin-Tap1a, Tap1a

A Blocker of Voltage-Gated Na+ and T-Type Ca2+ Channels

Back to product page SDS

Overview

Cat #: STT-600
Alternative Name Mu/omega-TRTX-Tap1a, Mu/omega-theraphotoxin-Tap1a, Tap1a
Lyophilized Powder yes
Origin Theraphosa apophysis (Goliath pinkfoot tarantula) (Pseudotheraphosa apophysis)
Source Synthetic peptide
MW: 4182.7 Da
Purity: >98%
Form Lyophilized Powder
Effective concentration 80 nM – 1 µM
Sequence DDCLGMFSSCDPNNDKCCPNRKCSRKDQWCKYQLW-OH
Modifications Disulfide bonds location: Cys3-Cys18, Cys10-Cys23, Cys17-Cys30
Molecular formula C174H258N52O55S7
Activity Nav1.1, Nav1.2, Nav1.3, Nav1.6, Nav1.7 and Cav3.1 blocker at nanomolar concentrations (IC50=81-301 nM). Surprisingly, selectively slows fast inactivation of Nav1.3. Also shows moderate inhibition of Cav3.2 (IC50=1233 nM)1.
Accession number P0DQO3
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in double distilled water (ddH2O). For long-term storage in solution, we recommend to prepare a stock solution by dissolving the product in ddH2O at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer.
Storage of solutions The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thaw cycles.
Scientific background

µ/ω-TRTX-Tap1a (Tap1a) is a 35 amino acid peptidyl toxin originally isolated from the venom of the tarantula, Theraphosa apophysis. Tap1a inhibits voltage-gated sodium (NaV) and voltage-gated calcium (CaV)3 channels by inducing a hyperpolarizing shift in both voltage-dependent activation and steady state inactivation1. Tap1a specifically inhibits NaV1.7, NaV1.2, and CaV3.1 with nanomolar potency and NaV1.3, NaV1.6, NaV1.1, and CaV3.2 at low micromolar concentrations1. These ion channels participate in neuron polarization, transmission of somatosensory signals, as well as neuronal cell differentiation, death, and survival. Thus, they are involved in many diseases, including pain disorders, epilepsy, and age-related neurodegeneration.

Spider peptides modulate an array of ion channels and receptor proteins. Knottins, which are a subtype of spider peptides, are also referred to as inhibitor cystine knot (ICK) peptides. ICK peptides harbor a disulfide-rich structural motif that forms a “knot”, which confers high structural, thermal, and proteolytic stability. The modelled structure of Tap1a revealed an ICK fold typical of spider venom peptides, as well as a hydrophobic patch involved in the binding of spider venom peptides to CaV3 and NaV channels1.

CaV3 are T-type, low voltage-gated calcium channels. Their electrophysiological properties include low voltage thresholds for activation and inactivation, rapid inactivation, and rebound bursting. These properties are responsible for the CaV3-mediated fine-tuned regulation of neuronal excitability in both the central nervous system (CNS) and peripheral nervous system (PNS)2.

CaV3.1 is highly expressed in the brain amygdala, subthalamic nuclei, cerebellum, and thalamus. In contrast, CaV3.1 is only moderately expressed in the heart. CaV3.1 participates in neuron polarization, synaptic transmission, as well as neuronal cell differentiation, death, and survival. CaV3.1 was implicated in the process of age-related neurodegeneration, Parkinson’s disease, and Alzheimer’s disease3. Moreover, mutations in CaV3.1 have been shown to induce cerebellar ataxia. CaV3.2 channels are expressed in the thalamus where they play a role in the pathophysiology of epilepsy. In addition, the constitutive deletion of the CaV3.2 gene alleviates acute pain, inflammatory pain, and chronic visceral pain in mice4.

NaV1.1–1.9 are voltage-gated sodium channels. They open upon depolarization of the membrane and inactivate rapidly before returning to the closed state upon membrane hyperpolarization. The rapid influx of Na+ ions is vital to the generation and propagation of action potential (AP) as well as the transmission of somatosensory signals.

NaV1.7 is expressed in the PNS, dorsal root ganglia neurons, visceral sensory neurons, olfactory sensory neurons, trigeminal ganglia, and sympathetic neurons. NaV1.7 gain-of-function mutations have been identified in patients with various pain disorders, such as inherited erythromelalgia (IEM), paroxysmal extreme pain disorder (PEPD), small fiber neuropathy (SFN), and painful diabetic peripheral neuropathy5.

NaV1.2 is abundantly expressed at the nodes of Ranvier and in the axon initial segment (AIS) during early development. NaV1.2 plays a dominant role in the initiation and propagation of APs. In mature neurons, NaV1.6 takes the role of AP initiation, and   NaV1.2 merely augments APs. Pathogenic variants of NaV1.2 are common causes of neurodevelopmental disorders such as episodic ataxia, schizophrenia, autism spectrum disorder, and intellectual disability with and without seizures6.

Target NaV channels and T-type Ca2+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-CACNA1G (CaV3.1) Antibody (#ACC-021)
  2. Anti-CACNA1G (CaV3.1)-ATTO Fluor-594 Antibody (#ACC-021-AR)
  3. Anti-CaV3.2 (CACNA1H) Antibody (#ACC-025)
  4. Anti-NaV1.7 (SCN9A) (extracellular) Antibody (#ASC-027)
  5. Anti-NaV1.7 (SCN9A) Antibody (#ASC-008)
  6. Anti-NaV1.7 (SCN9A)-ATTO Fluor-633 Antibody (#ASC-008-FR)
  7. Anti-SCN2A (NaV1.2) Antibody (#ASC-002)
  8. Anti-SCN2A (NaV1.2)-ATTO Fluor-594 Antibody (#ASC-002-AR)
  9. Guinea pig Anti-NaV1.7 (SCN9A) Antibody (#ASC-008-GP (formerly AGP-057))
  10. Guinea pig Anti-SCN2A (NaV1.2) Antibody (#ASC-002-GP (formerly AGP-026))

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. GTx1-15 (#STT-300)
  2. Huwentoxin-IV (#STH-100)
  3. Huwentoxin-XVI (#STH-105)
  4. Iota-Conotoxin RXIA (#STI-300)
  5. Kurtoxin (#STK-800)
  6. Pe1b (#STP-050)
  7. Phlotoxin 1 (#STP-800)
  8. ProTx-I (#STP-400)
  9. ProTx-II (#STP-100)
  10. ProTx-II-Biotin (#STP-100-B)
  11. µ-Conotoxin PIIIA (#STC-400)
Blockers/Antagonists: small molecules
  1. ML 218 (#M-165)
  2. ML 218 hydrochloride (#M-166)
  3. NaV1.7-Compound 36 (#CMN-003)
  4. PF-05186462 (#P-365)
  5. Tetrodotoxin citrate (#T-550)
  6. XEN907 (#X-105)
Activators/Agonists: peptides/peptide toxins
  1. Anthopleurin-C (#STA-400)
  2. Jingzhaotoxin-II (#STJ-150)
Activators/Agonists: small molecules
  1. Aconitine (#A-150)
  2. Veratridine (#V-110)
Modulators: peptides/peptide toxins
  1. 1Kα-Pompilidotoxin (#P-172)
  2. 1Kβ-Pompilidotoxin (#P-182)
  3. 3R12Rα-Pompilidotoxin (#P-176)
  4. 3Rα-Pompilidotoxin (#P-174)
  5. α-Pompilidotoxin (#P-170)
  6. β-Pompilidotoxin (#P-180)

Explorer kits & Research packs

Explorer kits
  1. NaV Channel Activator Explorer Kit (#EK-203)
  2. NaV Channel Blockers for Pain Research Explorer Kit (#EK-375)
  3. NaV Channel Antibodies for Pain Research Explorer Kit (#AK-365)
  4. NaV1.2 Channel Basic Research Pack (#ESB-002)
  5. T-Type CaV Channel Blocker Explorer Kit (#EK-111)
  6. TTX-Sensitive NaV Channel Blocker Explorer Kit (#EK-105)
Research packs
  1. NaV1.7 Channel Deluxe Research Pack (#ESD-001)
  2. T-Type CaV Channel Basic Research Pack (#ESB-101)
  3. T-Type CaV Channel Deluxe Research Pack (#ESD-101)
  4. T-Type CaV Channel Premium Research Pack (#ESP-101)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order