Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ligand-Gated Ion Channels › Nicotinic Acetylcholine Receptors › Antagonists

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

α-Bungarotoxin-ATTO Fluor-633

Long neurotoxin 1, α-Bgtx, α-BuTX

A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites

Back to product page SDS

Overview

Cat #: B-100-FR
Alternative Name Long neurotoxin 1, α-Bgtx, α-BuTX
Lyophilized Powder yes
Origin Modified natural protein isolated from Bungarus multicinctus (Many-banded krait).
MW: ~9140 Da
Purity: >95% (HPLC)
Form Lyophilized powder.
Effective concentration 1 nM - 3 μM.
Sequence IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG.
Modifications Disulfide bonds between Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys59 and Cys60-Cys65.
Label ATTO-633. ATTO dyes are characterized by strong absorption (high extinction coefficient), high fluorescence quantum yield, and high photo-stability. ATTO-633 maximum absorption is 629 nm and maximum fluorescence is at 657 nm. The fluorescence is excited most efficiently in the 610-645 nm range. This label is analogous to the well known dye Alexa 647, Alexa 633 and Cy5. The extent of labeling is 1-3 molecules of dye per molecule α-Bungarotoxin.
Structure
Activity α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 μM)1,2. The toxin also blocks GABA(A) receptor subtypes3.
References-Activity
  1. Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687.
  2. Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647.
  3. McCann, C.M. et al. (2006) Proc. Natl. Acad. Sci. U.S.A. 103, 5149.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Avoid exposure to light.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). The product is lyophilized in 0.5 ml conical vial. Avoid exposure to light.
Storage of solutions Up to two weeks at 4°C or three months at -20°C. Avoid exposure to light.
Our bioassay
  • Alomone Labs α-Bungarotoxin-ATTO Fluor-633 inhibits muscle nACh receptors heterologously expressed in Xenopus oocytes.
    Alomone Labs α-Bungarotoxin-ATTO Fluor-633 inhibits muscle nACh receptors heterologously expressed in Xenopus oocytes.
    A. Time course of muscle nicotinic ACh channel current recording. Membrane potential was held at -80 mV and stimulated every 100 sec with a solution containing 100 µM ACh + 3 μM PNU-120596. 50 nM α-Bungarotoxin-ATTO Fluor-633 (#B-100-FR) was applied (green) for 5 min during the ACh application and inhibited channel current. B. Superimposed examples of muscle nicotinic ACh current in the absence (black) and presence (green) of 50 nM α-Bungarotoxin-ATTO Fluor-633 (taken from the experiment in A).
Scientific background

α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1.

α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2.

The toxin is selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 µM)3,4.

α-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR β3 subunit. In particular, α-Bungarotoxin blocks GABAARs that contain interfaces between adjacent β3 subunits5.

Target α7, α1/β1/γ/δ nAChR and GABA(A) receptor subtypes
Peptide Content: 100%
Lyophilized Powder
Image & Title

α-Bungarotoxin-ATTO Fluor-633Alomone Labs α-Bungarotoxin-ATTO Fluor-633 in whole mount staining of mice neuromuscular junction (NMJ)Whole mount staining of mouse neuromuscular junction (NMJ) was stained with the NMJ marker α-Bungarotoxin-ATTO Fluor-633 (#B-100-FR) (purple) at 1 µg/ml concentration.The image was taken using Nikon Epifluorescence microscopy at 60X magnification and is kindly provided by Dr. Eran Perlsson, Dept. of Physiology and Pharmacology, Tel-Aviv University, Tel-Aviv, Israel.

For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-Nicotinic Acetylcholine Receptor α1 (CHRNA1) (extracellular) Antibody (#ANC-001)
  2. Anti-Nicotinic Acetylcholine Receptor α3 (CHRNA3) (extracellular) Antibody (#ANC-003)
  3. Anti-Nicotinic Acetylcholine Receptor α7 (CHRNA7) (extracellular) Antibody (#ANC-007)
  4. Anti-Nicotinic Acetylcholine Receptor α7 (CHRNA7) (extracellular)-ATTO Fluor-633 Antibody (#ANC-007-FR)
  5. Anti-Nicotinic Acetylcholine Receptor α7 (CHRNA7) (extracellular)-FITC Antibody (#ANC-007-F)
  6. Anti-Nicotinic Acetylcholine Receptor β4 (CHRNB4) (extracellular) Antibody (#ANC-014)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. α-Bungarotoxin (#B-100)
  2. α-Bungarotoxin-ATTO Fluor-488 (#B-100-AG)
  3. α-Bungarotoxin-Biotin (#B-100-B)
  4. α-Bungarotoxin-FITC (#B-100-F)
  5. α-Conotoxin ImI (#C-290)
  6. α-Conotoxin AuIB (#STC-310)
  7. α-Conotoxin LtIA (#STC-550)
Activators/Agonists: small molecules
  1. PNU-120596 (#P-350)
  2. PNU 282987 (#P-110)
Modulators: peptides/peptide toxins
  1. α-Conotoxin MrIC (#STC-320)

Explorer kits & Research packs

Explorer kits
  1. nAChR Antagonist Explorer Kit (#EK-205)
  2. nAChR Modulator Explorer Kit (#EK-202)
  3. nAChR Antibody Explorer Kit (#AK-203)
  4. Classical Ion Channel Blockers for Pain Research Explorer Kit (#EK-355)
  5. Muscle Specific nAChR Antagonist Explorer Kit (#EK-207)
  6. GABA(A) Receptor Modulator Explorer Kit (#EK-360)
Research packs
  1. Muscle-Type nAChR Basic Research Pack (#ESB-900)
  2. Muscle-Type nAChR Premium Research Pack (#ESP-900)
  3. Muscle-Type nAChR Deluxe Research Pack (#ESD-900)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order