Overview
Cat #:
B-300
Alternative Name kappa-Bungarotoxin, Kappa-bgt, Kappa-1-bungarotoxin, Long neurotoxin 2,
Neuronal bungarotoxin, nBgt, Toxin F
Lyophilized Powder yes
Origin Bungarus multicinctus (Many-banded krait)
Source Natural peptide
MW: 7265 Da
Purity: >98%
Form Lyophilized Powder
Effective concentration 5 -25 nM
Sequence RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCT TDNCNH-OH
Modifications Disulfide bonds location- Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64
Molecular formula C303H475N91O97S10
Activity Kappa-bungarotoxin is a postsynaptic neurotoxin that potently binds and inhibits the neuronal types of nicotinic acetylcholine receptors (nAChR). It is a selective antagonist of most α3-containing and some α4-containing nAChRs subunits1.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
Solubility Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles. Centrifuge all product preparations before use (10,000 g for 1 min).
Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C.
Scientific background Kappa-bungarotoxin (κ-Bungarotoxin, κ-Bgt) is a 66 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1,2. κ-Bgt is a postsynaptic neurotoxin that potently binds and inhibits the neuronal types of nicotinic acetylcholine receptors (nAChR). It is a selective antagonist of α3-containing and some α4-containing nAChRs subunits3.
Under physiological solvent conditions, κ-Bungarotoxin exists as a non-covalent homodimer4. The dimeric nature of the toxin may play a crucial role in the binding properties of κ-Bgt to neuronal types of AChRs while losing its potency on muscle receptors4-6.
Neuronal nicotinic acetylcholine receptors (nAChRs) are prototypical cation-selective, ligand-gated ion channels that mediate fast neurotransmission in the central and peripheral nervous systems. nAChRs are involved in a range of physiological and pathological functions and hence are important therapeutic targets7. The κ-neurotoxins have been valuable pharmacological tools in the study of neuronal AChRs3.
Target α3/β2 Neuronal nAChR
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
