Overview
Cat #:
STA-305
Alternative Name Potassium channel toxin α-KTx 15.3
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3822 Da
Purity: >98% (HPLC)
Effective concentration 1-5 µM.
Sequence ZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP.
Modifications Disulfide bonds between Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35. Z= Pyrrolidone carboxylic acid.
Molecular formula C158H262N50O48S6.
Activity AamTx3 Toxin is a blocker of A-type voltage-gated K+ channels as well as ERG1, KV11.1 and KCNH2 K+ channels1,2.
References-Activity
- Maffie, J.K. et al. (2013) J. Physiol. 591, 2419.
- Vacher, H. et al. (2002) Eur. J. Biochem. 269, 6037.
Accession number P60208.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs AmmTx3 Toxin inhibits KV4.2 currents heterologously expressed in Xenopus oocytes.A. Time course of AmmTx3 Toxin (#STA-305) blocking action on KV4.2 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at –90 mV and cells were stimulated by a 120 ms voltage step to 0 mV. 5 µM AmmTx3 Toxin were perfused as indicated by the bar (green) during 280 sec application. B. Superimposed examples of KV4.2 channel current in the absence (control) and presence (green) of 5 µM AmmTx3 Toxin (taken from the experiment in A).
Scientific background
AmmTX3 is a member of the α-KTX15 family of scorpion toxins which includes 6 homologous peptides found in four species of scorpion venoms -Aa1, AaTX1, AaTX2, AmmTX3, BmTX3 and Discrepin. AmmTx3 shares homology of 94% with Aa1 and 91% with BmTx3 and is originally isolated from the venom of the scorpion Androctonus mauretanicus. This toxin selectively blocks A-type K+ channels in cerebellum granular cells or cultured striatum neurons from rat brain.
AmmTx3 is a pore blocker of KV4.2 and KV4.3 subunits and requires for its action the expression of the KV4 associated protein dipeptidyl peptidase-like proteins 6 (DPP6). AmmTX3 structure consists of a single chain of 37 amino acid residues cross-linked by three disulphide bridges1,2.
Target KV4 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations
