Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Inward Rectifier K+ Channels › Antibodies to Kir Channels

Certificate of Analysis

  • KO Validated
    This antibody has undergone quality control and has been approved by our professional team. See applications.

Anti-GIRK1 (Kir3.1) Antibody

KCNJ3, G protein-activated inward rectifier potassium channel 1

Back to product page SDS

Overview

Cat #: APC-005
Alternative Name KCNJ3, G protein-activated inward rectifier potassium channel 1
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250). Intracellular, C-terminus.
Accession (Uniprot) Number P63250
Gene ID 16519
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Rat - identical; human - 64/66 amino acid residues identical; guinea pig - 63/66 amino acid residues identical; chicken - 59/66 amino acid residues identical.
RRID AB_2040113.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.6 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, ip, wb
May also work in: ifc*
Western blot
  • Rat brain membranes (1:200).
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-GIRK1 (Kir3.1) Antibody (#APC-005), (1:200).
    2. Anti-GIRK1 (Kir3.1) Antibody, preincubated with the control antigen.
Immunoprecipitation
  • Mouse atrial myocytes (Cui, S. et al. (2010) J. Biol. Chem. 285, 41732.).
Immunohistochemistry
  • Rat brain sections.

    Human skin sections (1:200) (Nockemann, D. et al. (2013) EMBO Mol. Med. 5, 1263.).
Immunocytochemistry
  • Mouse INS-IE cells (Iwanir, S. and Reuveny, E. (2008) Pflughers Arch. 456, 1097.).
Scientific background

Kir3.1 (or G-protein regulated inward-rectifier K+ channel 1, GIRK1) is a member of the family of inward rectifying K+ channels. The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.

The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels, the functional unit for the Kir channels is composed of four subunits that can assemble as either homo- or heterotetramers.

Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.

Kir3.1 is a member of the Kir3.x subfamily that includes four members (Kir3.1- Kir3.4). The Kir3 family is characterized by the fact that the channels can be activated by neurotransmitters and other factors acting via the activation of G-protein coupled receptors. Binding of the corresponding ligand to the G-protein receptor induces the dissociation of Gα-GTP from the Gβγ dimer. The latter directly binds to Kir3 and activates the channel1,3.

In the heart, Kir3.1 co-assembles with Kir3.4 to form the prototypical muscarinic-gated K+ channel KAch current, responsible for slowing the heart rate in response of parasympathetic stimulation2.

In the brain, Kir3.1 co-assembles with Kir3.2 and mediates the inhibitory effects of many neurotransmitters including opioid, adrenergic, muscarinic, dopaminergic and γ-aminobutyric acid (GABA)1,3.

A peptide toxin originating from the Apis mellifera bee venom, Tertiapin (#STT-250) was shown to be a potent blocker of Kir3.1 containing channels (8.6 nM for the Kir3.1/3.4 combination and 5.4 nM for the Kir3.1/3.2)4,5.

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Lyophilized Powder
Image & Title:

Anti-GIRK1 (Kir3.1) Antibody
Knockout validation of Anti-GIRK1 (Kir3.1) Antibody in mouse VNO neuronsImmunohistochemical staining of wild-type (left panel) and Girk1–/– (right panel) VNO neurons using Anti-GIRK1 (Kir3.1) Antibody (#APC-005).Adapted from Kim, S. et al. (2012) Nat. Neurosci. 15, 1236. with permission of Nature America.

For research purposes only, not for human use
Last Update: 03/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • GIRK1/Kir3.1 Blocking Peptide (#BLP-PC005) is the original antigen used for immunization during Anti-GIRK1 (Kir3.1) Antibody (#APC-005) generation. The blocking peptide binds and ‘blocks’ Anti-GIRK1/Kir3.1 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

    GIRK1/Kir3.1 Blocking Peptide (#BLP-PC005)

Related Products

Antibodies

  1. Anti-GIRK2 (Kir3.2) Antibody (#APC-006)
  2. Anti-GIRK3 (Kir3.3) Antibody (#APC-038)
  3. Anti-KCNJ5 (Kir3.4) Antibody (#APC-027)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Tertiapin-LQ (#STT-220)
  2. Tertiapin-Q (#STT-170)
  3. Tertiapin-Q-ATTO Fluor-488 (#STT-170-AG)
  4. Tertiapin-Q-ATTO Fluor-633 (#STT-170-FR)
  5. Tertiapin (#STT-250)

Explorer kits & Research packs

Explorer kits
  1. GIRK (Kir3) Channel Antibody Explorer Kit (#AK-227)
  2. Kir Channel Antibody Explorer Kit (#AK-200)
  3. Cardiac Kir Channel Antibody Explorer Kit (#AK-330)
  4. K+ Channel Antibodies for Pain Research Explorer Kit (#AK-390)

Resources

  • K+ Channels and Cancer: Surprising New Discoveries
  • K+ Channels in Cardiomyocytes

General Protocols

  • Blocking Peptides – Controls for better results
  • Blocking Peptide Protocol for Western Blot (WB)
  • Immunohistochemistry (IHC) Protocols for Frozen Sections: Indirect Methods
  • Sample Preparation Protocols for Tissues
  • Western Blot (WB) Protocol

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • K+ Channels and Cancer: Surprising New Discoveries

  • K+ Channels in Cardiomyocytes

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µl free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order