Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Antibodies to KV Channels

Certificate of Analysis

Anti-KV1.2 (KCNA2) Antibody

Potassium voltage-gated channel subfamily A member 2, RBK2

Back to product page SDS

Overview

Cat #: APC-010
Alternative Name Potassium voltage-gated channel subfamily A member 2, RBK2
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Accession (Uniprot) Number P63142
Gene ID 25468
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Mouse, dog, human, - identical.
RRID AB_2313792.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.8 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, wb
May also work in: ifc*, ip*
Western blot
  • Rat brain membranes (1:200-1:400) and rat heart membranes (1:200).
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200).
    2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
  • Western blot analysis of rat heart membranes:
    Western blot analysis of rat heart membranes:
    1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200)
    2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
Immunohistochemistry
  • Rat and mouse brain sections brain sections (1:300).

    Mouse cerebellum (1:350) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
Immunocytochemistry
  • HeLa transfected cells (1:200) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
Scientific background

KV1.2 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.2 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.2 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2

The channel is expressed in neurons and cardiac and smooth muscle tissue as well as in retina and pancreas.2 The crystal structure of KV1.2 was recently solved shading light on the structure of a mammalian voltage dependent channel.3 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.

KV1.2 channels are sensitive to high doses of TEA (560 mM) and low doses of 4-AP (0.59 mM), the “classical” non-selective potassium channel blockers.

Several venomous toxins from snakes, scorpions and honey bee are potent blockers (affecting the channels in the nanomolar range) of KV1.2 channels. Among these, the most potent and selective are α-Dendrotoxin (1-12 nM), Dendrotoxin-I (0.13 nM), Maurotoxin (0.1-0.8 nM), Hongotoxin-1 (0.17 nM), Margatoxin (0.16-0.65 nM), Tityustoxin Kα (0.21 nM) and MCD peptide (10-400 nM).4

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Lyophilized Powder
For research purposes only, not for human use
Last Update: 03/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010) is the original antigen used for immunization during Anti-KV1.2 (KCNA2) Antibody (#APC-010) generation. The blocking peptide binds and ‘blocks’ Anti-Kv1.2/KCNA2 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

    Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010)

Related Products

Antibodies

  1. Anti-KV1.1 (KCNA1) (extracellular) Antibody (#APC-161)
  2. Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101)
  3. Anti-KV1.4 (extracellular) Antibody (#APC-167)
  4. Anti-KV1.5 (KCNA5) (extracellular) Antibody (#APC-150)
  5. Anti-KV1.6 (KCNA6) Antibody (#APC-003)
  6. Anti-Mouse KV1.7 (KCNA7) Antibody (#APC-063)
  7. Anti-KV1.8 Antibody (#APC-157)
  8. Anti-Calnexin Antibody (#ACS-009)
  9. Anti-Calnexin-ATTO Fluor-594 Antibody (#ACS-009-AR)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Agitoxin-3 (#STA-390)
  2. Dendrotoxin-I (#D-390)
  3. Hemitoxin (#STH-500)
  4. Hongotoxin-1 (#RTH-400)
  5. Margatoxin (#STM-325)
  6. Maurotoxin (#STM-340)
  7. MCD peptide (#STM-250)
  8. Spinoxin (#STS-500)
  9. Tityustoxin-Kα (#STT-360)
  10. Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR)
  11. Urotoxin (#STU-200)
  12. α-Dendrotoxin (#D-350)
  13. κ-Conotoxin RIIIK (#STC-650)

Explorer kits & Research packs

Explorer kits
  1. Shaker (KV1) Channel Antibody Explorer Kit (#AK-219)
  2. Shaker (KV1) Channel Blocker Explorer Kit (#EK-107)
  3. pH-Sensitive KV Channel Antibody Explorer Kit (#AK-470)
Research packs
  1. KV1.2 (KCNA2) Channel Basic Research Pack (#ESB-500)
  2. KV1.2 (KCNA2) Channel Premium Research Pack (#ESP-500)
  3. KV1.2 (KCNA2) Channel Deluxe Research Pack (#ESD-500)

Resources

  • Voltage-Dependent K+ (KV) Channels: A Large and Diverse Family of Membrane Voltage Regulators
  • The Role of Ion Channels in Neurodegeneration
  • The Involvement of Ion Channels in Cell Proliferation
  • Characterization of Neuronal K+ Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Voltage-Dependent K+ (KV) Channels: A Large and Diverse Family of Membrane Voltage Regulators

  • The Role of Ion Channels in Neurodegeneration

  • The Involvement of Ion Channels in Cell Proliferation

  • Characterization of Neuronal K+ Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µl free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order