Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Antibodies to KV Channels

Certificate of Analysis

Anti-KCNH2 (HERG) Antibody

KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1

Back to product page SDS

Overview

Cat #: APC-062
Alternative Name KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Accession (Uniprot) Number Q12809
Gene ID 3757
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.
RRID AB_2039908.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Isotype Rabbit IgG.
Specificity The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.6 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, ip, wb
May also work in: ifc*
Western blot
  • HEK 293-HERG transfected cells (1:200-1:600). Neonatal rat ventricular myocytes (NRVMs) (see Dennis, A.T. et al. (2011) J. Biol. Chem. 286, 34413.).
  • Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells:
    Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells:
    1. Anti-KCNH2 (HERG) Antibody (#APC-062), (1:400).
    2. Anti-KCNH2 (HERG) Antibody, preincubated with KCNH2/HERG Blocking Peptide (#BLP-PC062).
Immunoprecipitation
  • KV11.1 (HERG)-expressing HEK-293 cells (2-5 µg).
Immunohistochemistry
  • Mouse frozen heart sections (1:300) (Teng, G.Q. et al. (2008) Circ. Res. 103, 1483.).
Immunocytochemistry
  • KV11.1 (HERG) in HEK-293 transfected cells (1:100-1:200).
Scientific background

The KV11.1 (HERG) channel is a member of the ether-a-go-go (EAG) subfamily of voltage-dependent K+ channels that includes the related proteins KV11.2 and KV11.3 (erg2 and erg3). KV11.1 possesses the signature structure of the voltage-dependent K+ channels: six membrane-spanning domains and intracellular N- and C-termini.

The KV11.1 current is characterized by strong inward rectification with slow activation and very rapid inactivation kinetics. The channel is expressed in the brain and heart (where it underlies the IKr current) and has a central role in mediating repolarization of action potentials.1,2

Mutations in the KV11.1 channel cause inherited long QT syndrome (LQTS) or abnormalities in the repolarization of the heart that are associated with life-threatening arrhythmias and sudden death. All the identified KV11.1 mutations produce loss of function of the channel via several cellular mechanisms ranging from alterations of gating properties, alterations of channel permeability/selectivity and alterations in intracellular channel trafficking that decreases the number of channels that reach the cell membrane.1,2 

Recently, drug-induced forms of LQTS have been reported for a wide range of non-cardiac drugs including antihistamines, psychoactive agents and antimicrobials. All these drugs potently block the KV11.1 channel as an unintended side effect, prompting regulatory drug agencies to issue recommendations for the testing of new drugs for their potential KV11.1 blocking effect.

In addition, KV11.1 expression was found to be upregulated in several tumor cell lines of different histogenesis, suggesting that it confers the cells some advantage in cell proliferation. Indeed, in several studies it has been shown that inhibition of the KV11.1 current leads to a decrease in tumor cell proliferation.3

Several toxins from scorpion venoms are potent blockers (affecting the channels in the nanomolar range) of KV11.1 channels. Among these the most potent and selective are Ergtoxin-1 (16 nM)4 and BeKM-1 (3 nM).5 In addition, the methanesulfonanilide class III antiarrhythmic agent E-4031 also blocks KV11.1 channel in the nanomolar range (7.7 nM).6

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Lyophilized Powder
For research purposes only, not for human use
Last Update: 03/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • KCNH2/HERG Blocking Peptide (#BLP-PC062) is the original antigen used for immunization during Anti-KCNH2 (HERG) Antibody (#APC-062) generation. The blocking peptide binds and ‘blocks’ Anti-KCNH2/HERG primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

    KCNH2/HERG Blocking Peptide (#BLP-PC062)

Related Products

Antibodies

  1. Anti-KCNH6 (erg2) Antibody (#APC-114)
  2. Anti-KCNH7 (erg3) Antibody (#APC-112)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. BeKm-1 (#STB-470)
  2. Ergtoxin-1 (#STE-450)
  3. GsAF-I (#STG-300)
  4. Haplotoxin-2 (#STT-200)
Blockers/Antagonists: small molecules
  1. E-4031 (#E-500)
  2. Trimethylapigenin (#T-145)
Activators/Agonists: small molecules
  1. NS-1643 (#N-115)
  2. NS-3623 (#N-190)

Explorer kits & Research packs

Explorer kits
  1. hERG and hERG-Related Channel Antibody Explorer Kit (#AK-222)
  2. hERG Related Channel Modulator Explorer Kit (#EK-109)
  3. Cardiac KV Channel Antibody Explorer Kit (#AK-320)
  4. Long QT Syndrome-Related Antibody Explorer Kit (#AK-350)
  5. pH-Sensitive KV Channel Antibody Explorer Kit (#AK-470)
  6. Pacemaker Cell Marker Antibody Kit (#AK-620)

Resources

  • K+ Channels and Cancer: Surprising New Discoveries
  • Ion Channels in Cancer
  • Targeting Ion Channels in Living Cells
  • K+ Channels in Cardiomyocytes
  • The Involvement of Ion Channels in Cell Proliferation

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • K+ Channels and Cancer: Surprising New Discoveries

  • Ion Channels in Cancer

  • Targeting Ion Channels in Living Cells

  • K+ Channels in Cardiomyocytes

  • The Involvement of Ion Channels in Cell Proliferation

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µl free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order