Overview
Cat #:
STA-160
Alternative Name Toxin APETx2, Pi-AITX-Ael2b, Pi-actitoxin-Ael2b
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4561 Da
Purity: >98% (HPLC)
Effective concentration 10 nM - 3 µM.
Sequence GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD.
Modifications Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38.
Structure
Molecular formula C196H280N54O61S6.
CAS No.: 713544-47-9
Activity APETx2 inhibits ASIC3 channels1.
References-Activity
- Chagot, B. et al. (2005) Protein Sci. 14, 2003.
Accession number
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
Alomone Labs APETx2 inhibits ASIC3 channels expressed in Xenopus oocytes.A.Time course of APETx2 (#STA-160) inhibition of ASIC3 channels current. Membrane potential was held at -60 mV, current was elicited every 50 sec by a transient applications of pH 5.5, and was inhibited significantly by 4 min applications of 0.5 µM and 1 µM APETx2, as indicated by horizontal bars. B.Superimposed traces of ASIC3 currents upon application of control, 0.5 µM and 1 µM APETx2 (taken from the experiment in A).
Scientific background
Natural APETx2 is a 42-amino-acid peptidyl toxin, originally isolated from the sea anemone Anthopleura elegantissima. APETx2 was shown to be a selective, potent and reversible blocker of the homodimer proton gated channel ASIC3. ASIC3 has been implicated in pain transduction associated with acidosis in inflamed or ischemic tissues. APETx2 directly inhibits the ASIC3 channel by acting at its external side of the channel in a pH dependent manner.
APETx2 also inhibits the hetromer ASIC2b-ASIC3 channel but does not inhibit the activity of ASIC1 isoform1.
Structurally APETx2 is related to APETx1 a toxin that targets HERG K+ channel1,2.
Target ASIC3 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 22/03/2024
Specifications
Citations
Citations
