Cat #: BLP-QP004
Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only, not for human use
Properties
Sequence
- GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4 (Accession P47863).
Accession (Uniprot) Number P47863
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 µl double distilled water (DDW).
Concentration After Reconstitution 1.2 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004), (1:1000).
2. Anti-Aquaporin 4 (AQP4) (249-323) Antibody, preincubated with the control fusion protein (BLP-QP004).
Last update: 02/01/2024