Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Activators

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

ATX-II

Neurotoxin 2, Toxin ATX-II, As2, Anemonia viridis toxin 2, Av2, Delta-actitoxin-Avd1c 2

A Modulator of NaV Channels

Back to product page SDS

Overview

Cat #: STA-700
Alternative Name Neurotoxin 2, Toxin ATX-II, As2, Anemonia viridis toxin 2, Av2, Delta-actitoxin-Avd1c 2
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4935 Da
Purity: >98% (HPLC)
Effective concentration 10-100 nM.
Sequence GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ.
Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34 and Cys27-Cys45.
Structure
Molecular formula C213H323N63O61S6.
CAS No.: 60748-45-0
Activity ATX-II potently modulates voltage-gated Na+ channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes. ATX-II has been used as a powerful activator of TTX-sensitive and insensitive Na+ channels in various excitable tissue and cell types1-9.
References-Activity
  1. Romey, G. et al. (1976) Proc. Natl. Acad. U.S.A. 73, 4055.
  2. Tesseraux, I. et al. (1987) Naunyn Schmiedebergs Arch. Pharmacol. 336, 232.
  3. Nishio, M. et al. (1991) Br. J. Pharmacol. 104, 504.
  4. Cannon, S.C. and Corey, D.P. (1993) J. Physiol. 466, 501.
  5. Hoey, A. et al. (1994) Pharmacol. Toxicol. 75, 356.
  6. Chahine, M. et al. (1996) J. Membr. Biol. 152, 39.
  7. Fletcher, J.E. et al. (1999) Anesthisiology 90, 1294.
  8. Brand, S. et al. (2000) Eur. J. Neurosci. 12, 2387.
  9. Ravens, U. (1976) Naunyn Schmiedebergs Arch. Pharmacol. 296, 73.
Accession number

P01528

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs ATX-II enhances hNaV1.5 currents in stably transfected HEK cells.
    Alomone Labs ATX-II enhances hNaV1.5 currents in stably transfected HEK cells.
    hNaV1.5 currents were elicited by a 50 ms voltage step from the holding potential of -100 mV to -20 mV, applied every 20 sec, using whole-cell voltage clamp technique (bath solution contains TEA and pipette solution contains CsF). A. Time course, showing the effect of 0.05 nM, 0.5 nM, 5 nM and 50 nM ATX-II (#STA-700) on the current area, indicating a dose-dependent slowing of the hNaV1.5 inactivation. B. Superimposed traces of hNaV1.5 currents under control conditions and after 4-6 min perfusion with 0.05 nM, 0.5 nM, 5 nM and 50 nM ATX-II, as indicated.
Scientific background

ATX-II is a 47 amino acid peptidyl toxin, originally isolated from Anemonia sulcata sea anemone venom. It is a potent neurotoxin, which modulates voltage-gated Na+ channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes.

ATX-II has been used as a powerful activator of TTX-sensitive and -insensitive Na+ channels in various excitable tissue and cell types (at concentration range of 10-100 nM).1-9

Target Various NaV channels
Peptide Content: 100%
Lyophilized Powder
Image & Title ATX-II
Effects of ATX-II on rabbit cardiomyocytes.
Electrical stimulation-induced changes in [Na+]i in the absence (control) and presence of 5 nM ATX-II (#STA-700).Adapted from Kornyeyev, D. et al. (2016) Am. J. Physiol. 310, H426. with permission of The American Physiological Society.
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-SCN1A (NaV1.1) Antibody (#ASC-001)
  2. Anti-SCN2A (NaV1.2)-ATTO Fluor-594 Antibody (#ASC-002-AR)
  3. Anti-SCN3A (NaV1.3) (extracellular) Antibody (#ASC-023)
  4. Anti-SCN4A (NaV1.4) Antibody (#ASC-020)
  5. Anti-NaV1.5 (SCN5A) (493-511) Antibody (#ASC-005)
  6. Guinea pig Anti-SCN11A (NaV1.9) Antibody (#ASC-017-GP (formerly AGP-030))
  7. Anti-Pan NaV Antibody (#ASC-003)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. µ-Conotoxin PIIIA (#STC-400)
  2. Ceratotoxin-1 (#STC-680)
  3. Hainantoxin-IV (#STH-130)
  4. Phrixotoxin-3 (#STP-720)
  5. ProTx-III (#STP-150)
  6. Pterinotoxin-1 (#STT-100)
Blockers/Antagonists: small molecules
  1. NaV1.7-Compound 36 (#CMN-003)
  2. PF-05186462 (#P-365)
  3. QX-314 chloride (#Q-150)
  4. Tetrodotoxin citrate (#T-550)
Activators/Agonists: peptides/peptide toxins
  1. β-Pompilidotoxin (#P-180)
  2. AaH1 Toxin (#STA-155)
  3. Anthopleurin-C (#A-400)
  4. BmKI Toxin (#STB-100)
Activators/Agonists: small molecules
  1. Aconitine (#A-150)
  2. NaV1.1-Compound 3a (#CMN-002)
  3. Veratridine (#V-110)

Explorer kits & Research packs

Explorer kits
  1. NaV Channel Activator Explorer Kit (#EK-203)
  2. Ion Channel Activators for Pain Research Explorer Kit (#EK-395)
  3. TTX-Resistant NaV Channel Antibody Explorer Kit (#AK-223)
  4. TTX-Sensitive NaV Channel Antibody Explorer Kit (#AK-224)

Resources

  • Setting the Pace with NaV1.5 Channels
  • NaV1.7 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Setting the Pace with NaV1.5 Channels

  • NaV1.7 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order