Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ligand-Gated Ion Channels › Purinergic (P2X) Receptors › Agonists

Certificate of Analysis

BomoTx Toxin

BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin

A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist

Back to product page SDS

Overview

Cat #: NTB-200
Alternative Name BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin
Lyophilized Powder yes
Origin Natural peptide isolated from Bothrops moojeni (Brazilian lancehead pit viper).
MW: 13834 Da
Purity: >99% (HPLC)
Form Lyophilized powder.
Effective concentration 1 µM.
Sequence SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCKKADPC.
Modifications The exact location of the disulfide bridges is currently unknown.
Structure

  • The exact location of the disulfide bridges is currently unknown.
Molecular formula C598H942N166O181S15
Activity BomoTx Toxin excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.
References-Activity
  1. Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524.
Accession number A0A1S5XW05.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Scientific background

BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally isolated from the Brazilian lancehead pit viper (Bothrops moojeni). This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.

BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.

P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1–P2X72.

Target P2X2/P2X3 receptors
Peptide Content: 100%
Lyophilized Powder
Image & Title

BomoTx Toxin
BomoTx-induced currents are mediated by ATP.A. Representative current–voltage relationship of BomoTx-evoked conductance from transiently activated TG neurons demonstrates inwardly rectified currents that reverse at 0 mV. B. Representative whole-cell voltage-clamp experiments on TG neurons showing that Ro51 (a P2X3 receptor antagonist) blocks BomoTx-evoked current. C. BomoTx does not directly activate HEK cells expressing rat P2X2, P2X3, or P2X2/3 channels.Adapted from Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524. with permission of the National Academy of Sciences.

For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-P2X3 Receptor Antibody (#APR-016)
  2. Anti-P2X3 Receptor-ATTO Fluor-594 Antibody (#APR-016-AR)
  3. Anti-P2X3 Receptor (extracellular) Antibody (#APR-026)
  4. Anti-P2X2 Receptor Antibody (#APR-003)
  5. Anti-P2X2 Receptor-ATTO Fluor-594 Antibody (#APR-003-AR)
  6. Anti-P2X2 Receptor (extracellular) Antibody (#APR-025)
  7. Anti-Pannexin 1 Antibody (#ACC-234)
  8. Anti-Pannexin 2 (extracellular) Antibody (#ACC-232)
  9. Anti-Pannexin 3 Antibody (#ACC-233)

Pharmacological tools

Blockers/Antagonists: small molecules
  1. RO-3 (#R-190)
  2. Ro-51 (#R-195)
  3. A-317491 sodium salt hydrate (#A-380)
  4. AF-353 (#A-375)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 35 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order