Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Antibodies to KV Channels

Certificate of Analysis

Cardiac KV Channel Antibody Explorer Kit

A Screening Package of Cardiac KV Channel Antibodies Economically Priced

Back to product page
Cat #: AK-320
Size: 36 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.4 Antibody Cat #: APC-007

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
Homology
Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.

Kv1.4 Blocking Peptide Cat #: BLP-PC007

Size: 0.12 mg

Anti-KV1.5 (KCNA5) Antibody Cat #: APC-004

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HRETDHEEQAALKEEQGIQRRESGLDTGGQRKVSCSKASFHKTGGPLEST DSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTS RETDL, corresponding to amino acid residues 513-602 of mouse KV1.5 (Accession Q61762). Intracellular, C-terminus.
Homology
Rat - 86/90 amino acid residues identical; rabbit - 71/90 amino acid residues identical; human - 70/90 amino acid residues identical; bovine, dog - 66/90 amino acid residues identical.

Kv1.5/KCNA5 Blocking Peptide Cat #: BLP-PC004

Size: 0.12 mg

Anti-KV1.5 (KCNA5) (extracellular) Antibody Cat #: APC-150

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, LCI, WB Reactivity: H, R
Immunogen
Peptide (C)DERELLRHPPVP(K), corresponding to amino acid residues 268-279 of rat KV1.5 (Accession P19024). 1st extracellular loop.
Homology
Rat - 12/13 amino acid residues identical; human - 11/13 amino acid residues identical; mouse - 9/13 amino acid residues identical.

Kv1.5/KCNA5 (extracellular) Blocking Peptide Cat #: BLP-PC150

Size: 40 µg

Anti-Mouse KV1.7 (KCNA7) Antibody Cat #: APC-063

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M
Immunogen
Peptide TTRKAQEIHGKAPG(C), corresponding to amino acid residues 2-15 of mouse KV1.7 (Accession Q17ST2). Intracellular, N-terminus.
Homology
Mouse only.

Mouse Kv1.7/KCNA7 Blocking Peptide Cat #: BLP-PC063

Size: 40 µg

Anti-KV3.1b (KCNC1) Antibody Cat #: APC-014

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat KV3.1b (Accession P25122). Intracellular, C-terminus.
Homology
Mouse, human, dog – identical.

Kv3.1b/KCNC1 Blocking Peptide Cat #: BLP-PC014

Size: 40 µg

Anti-KCNC4 (KV3.4) Antibody Cat #: APC-019

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide EAGDD ERELA LQRLG PHEG(C), corresponding to amino acid residues 177-195 of rat KCNC4 (Accession Q63734). Intracellular, N-terminal.
Homology
Human - identical.

KCNC4/Kv3.4 Blocking Peptide Cat #: BLP-PC019

Size: 40 µg

Anti-KV4.2 Antibody Cat #: APC-023

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat KV4.2 (Accession Q63881). Intracellular, C-terminus.
Homology
Mouse, human - 15/16 amino acid residues identical.

Kv4.2 Blocking Peptide Cat #: BLP-PC023

Size: 40 µg

Guinea pig Anti-KV4.2 Antibody Cat #: APC-023-GP (formerly AGP-038)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat KV4.2 (Accession Q63881). Intracellular, C-terminus.
Homology
Mouse, human - 15/16 amino acid residues identical.

Kv4.2 Blocking Peptide Cat #: BLP-PC023

Size: 40 µg

Anti-KV4.3 Antibody Cat #: APC-017

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451-468 of human KV4.3 (Accession O60577). Intracellular, C-terminus.
Homology
Rat, rabbit - identical; mouse - 16/17 amino acid residues identical.

Kv4.3 Blocking Peptide Cat #: BLP-PC017

Size: 40 µg

Anti-KChIP2 Antibody Cat #: APC-142

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RGQGRKESLSDSRD, corresponding to amino acid residues 2-15 of human KChIP2 (Accession Q9NS61). Cytoplasmic, N-terminus.
Homology
Mouse - identical. Rat - 13/14 amino acid residues identical.

KChIP2 Blocking Peptide Cat #: BLP-PC142

Size: 40 µg

Anti-KCNE1 (IsK) Antibody Cat #: APC-163

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)RSKKLEHSHDPFN, corresponding to amino acid residues 68-80 of rat KCNE1 (Accession P15383). Intracellular, C-terminus.
Homology
Mouse, pig, dog – identical; human – 12/13 amino acid residues identical.

KCNE1/IsK Blocking Peptide Cat #: BLP-PC163

Size: 40 µg

Anti-KCNE2 (MiRP1) Antibody Cat #: APC-054

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)IVEDWQQKYRSQILHLEDSK, corresponding to amino acid residues 88-107 of rat KCNE2 (Accession P63161). Intracellular, C-terminal domain.
Homology
Mouse - 18/20 amino acid residues identical; human - 16/20 amino acid residues identical; rabbit - 15/20 amino acid residues identical.

KCNE2/MiRP1 Blocking Peptide Cat #: BLP-PC054

Size: 40 µg

Anti-KCNE3 (MiRP2) Antibody Cat #: APC-118

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RSRKVDKRSDPYH, corresponding to amino acid residues 81-93 of human KCNE3 (Accession Q9Y6H6). Intracellular, C-terminal part.
Homology
Rat, mouse, dog, pig -  identical.

KCNE3/MiRP2 Blocking Peptide Cat #: BLP-PC118

Size: 40 µg

Anti-KCNQ1 Antibody Cat #: APC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human KCNQ1 (Accession P51787). Intracellular, C-terminus.
Homology
Rat, mouse - 14/16 amino acid residues identical.

KCNQ1 Blocking Peptide Cat #: BLP-PC022

Size: 40 µg

Anti-KCNQ1 (extracellular) Antibody Cat #: APC-168

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, LCI, WB Reactivity: H, M, R
Immunogen
Peptide(C)EKDAVNESGRIEFG, corresponding to amino acid residues 284-297 of rat KCNQ1 (Accession Q9Z0N7). 3rd extracellular loop.
Homology
Mouse – identical; human – 13/14 amino acid residues identical.

KCNQ1 (extracellular) Blocking Peptide Cat #: BLP-PC168

Size: 40 µg

Anti-KCNH2 (erg1) Antibody Cat #: APC-016

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (CY)EEL PAGAP ELPQD GPT, corresponding to residues 1122-1137 of rat KV11.1 (erg1) (Accession O08962). Intracellular, C-terminal part.
Homology
Mouse - identical; human, dog, rabbit - 14/16 amino acid residues identical.

KCNH2/erg1 Blocking Peptide Cat #: BLP-PC016

Size: 40 µg

Anti-KCNH2 (HERG) Antibody Cat #: APC-062

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Homology
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

KCNH2/HERG Blocking Peptide Cat #: BLP-PC062

Size: 0.12 mg

Anti-KCNH2 (HERG) (extracellular) Antibody Cat #: APC-109

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, R
Immunogen
Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG) (Accession Q12809). Extracellular, between S1 and S2 domains.
Homology
Rat, mouse - 11/16 amino acid residues identical; dog, rabbit - 15/16 amino residues identical.

KCNH2/HERG (extracellular) Blocking Peptide Cat #: BLP-PC109

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A guinea pig polyclonal antibody (#APC-023-GP) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.
For research purposes only, not for human use

Related Products

  1. Anti-KV1.4 (extracellular) Antibody (#APC-167)
  2. Anti-KV1.5 (KCNA5)-ATTO Fluor-550 Antibody (#APC-004-AO)
  3. Anti-KV4.2-ATTO Fluor-633 Antibody (#APC-023-FR)
  4. Anti-KCNH2 (HERG) (extracellular)-FITC Antibody (#APC-109-F)
  5. Cardiac Channel Blocker Explorer Kit (#EK-345)
  6. hERG and hERG-Related Channel Antibody Explorer Kit (#AK-222)
  7. hERG Related Channel Modulator Explorer Kit (#EK-109)
  8. KV4 Channel Blocker Explorer Kit (#EK-130)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top