Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Cl- Channels › Voltage-Gated Cl- Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Chlorotoxin

CTX, Cltx

An Inhibitor of Chloride Channels

Back to product page SDS

Overview

Cat #: STC-460
Alternative Name CTX, Cltx
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3995 Da
Purity: >98% (HPLC)
Effective concentration 50-600 nM.
Sequence MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR.
Modifications Disulfide bonds between Cys2-Cys19, Cys5-Cys28, Cys16-Cys33 and Cys20-Cys35. Arg36 – C-terminal amidation.
Structure
Molecular formula C158H249N53O47S11.
CAS No.: 163515-35-3
Activity Chlorotoxin blocks small conductance Cl- channels of epithelial cells and also blocks Cl- channels expressed in gliomas1,2.
References-Activity
  1. DeBin, J.A. et al. (1993) Am. J. Physiol. 264, C361.
  2. Soroceanu, L. et al. (1999) J. Neurosci. 19, 5942.
Accession number P45639.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two week at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs Chlorotoxin inhibits Ca2+-activated Cl- currents.
    Alomone Labs Chlorotoxin inhibits Ca2+-activated Cl- currents.
    Inhibition of Ca2+-activated Cl- currents by Chlorotoxin (#STC-460) in human R2 astrocyte cell line. The data are taken from three experiments and the calculated IC50 was 68 nM.
Scientific background

Native chlorotoxin (CTX) is a 36-amino acid peptide, originally isolated from the venom of the giant yellow Israeli scorpion Leiurus quinquestriatus hebraeus. Its primary amino acid sequence shows considerable homology to a class of short insectotoxins.1

Initially, CTX was demonstrated as an irreversible inhibitor of small conductance Cl- channels in colonic epithelial cells and Cl- fluxes across glioma cell membranes.2,3 Inhibition of Cl- channels with CTX prevents cell volume changes, and in turn, inhibits tumor cell invasion and migration.4-6

Immunohistochemical studies show that CTX specifically and selectively binds to glioma cell lines and to tissue biopsies from patients with various malignant gliomas and other embryonic related tumors of neuroectodermal origin but not to normal brain tissue.

These findings have lead to clinical evaluation for the therapeutic and diagnostic use of CTX, a synthetic derivate, in patients with malignant glioma. This derivative of CTX has been shown to selectively label human gliomas in vivo and in vitro and demonstrated all of the known physical and biological activities of the naturally occurring CTX.7,8

Further studies on the interaction of CTX with Cl- channels suggest that these effects are indirect; affinity purification with a recombinant CTX identified the matrix metalloproteinase-2 (MMP2) as a CTX binder in glioma cells. The actual receptor for CTX appears to be a protein complex that contains MMP2 and Cl- channel 3 (ClC-3). Binding of CTX induces endocytosis of this complex and hence the ClC-3 channels. This finding might explain the irreversible action of CTX and its relatively slow time course of Cl- channel blockage.9,10

Target Chloride channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-CLC-1 (CLCN1) Antibody (#ACL-005)
  2. Anti-CLC-2 (CLCN2) Antibody (#ACL-002)
  3. Anti-CLC-3 (CLCN3) Antibody (#ACL-001)
  4. Anti-CLC-5 Antibody (#ACL-003)
  5. Anti-CLC-7 (CLCN7) Antibody (#ACL-008)
  6. Anti-CLC-K Antibody (#ACL-004)
  7. Anti-TMEM16A (ANO1) (extracellular) Antibody (#ACL-011)
  8. Anti-TMEM16B (ANO2) (extracellular) Antibody (#ACL-012)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Chlorotoxin (#RTC-450)

Explorer kits & Research packs

Explorer kits
  1. Voltage-Gated Cl- Channel Antibody Explorer Kit (#AK-415)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order