Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Activators

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Cn2 Toxin

Toxin 2, Toxin II.9.2.2, β-mammal toxin Cn2

An activator of Nav1.6

Back to product page SDS

Overview

Cat #: STC-060
Alternative Name Toxin 2, Toxin II.9.2.2, β-mammal toxin Cn2
Lyophilized Powder yes
Origin Centruroides noxius
Source Synthetic
MW: 7589 Da
Purity: >98% (HPLC)
Form Lyophilized powder
Effective concentration 0.02-0.5 µM
Sequence KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS-NH2
Modifications Disulfide bonds between: Cys12-Cys65, Cys16-Cys41, Cys25-Cys46, Cys29-Cys48
Ser66 - amidation
Structure
Molecular formula C336H495N89O97S8
Activity Cn2 toxin simultaneously induces both the left shift voltage-dependent activation and a transient resurgent current only in human Nav1.6 channels. Cn2 also produced both actions in mouse cerebellar Purkinje neurons and blocked firing at appropriate concentrations1.
References-Activity
  1. Schiavon, E. et al. (2006) J. Biol. Chem. 281, 20326.
Accession number P01495 (Uniprot)
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in DDW.
Centrifuge all products before use (10000 x g 5 min).
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
Our bioassay
  • Alomone Labs Cn2 Toxin activates Nav1.6 channels expressed in Xenopus oocytes.

    Alomone Labs Cn2 Toxin activates Nav1.6 channels expressed in Xenopus oocytes.
    A. Representative traces of Nav1.6 channel currents before and after application of 100 nM (magenta) and 500 nM (green) Cn2 Toxin (#STC-060). Cn2 Toxin caused a significant current at a voltage that does not normally activate the channels. A double protocol with an initial holding potential of -120 mV was conditioned by a prepulse of +35 mV for 20 ms, while the second pulse to -40 mV for 50 ms was preceded by 30 ms at -100 mV.
    B. Representative time course of current amplitude at -40 mV before, during application of 100 nM and 500 nM Cn2 Toxin (indicated by bars) and upon wash, demonstrating the current amplitude enhancement.
Scientific background

Cn2 Toxin is a β-scorpion toxin, isolated from the venom of Centruroides noxius, a Mexican native scorpion species. It belongs to the scorpion β-toxins family that bind to the voltage-sensing domain of voltage-gated sodium (NaV) channels and trap the voltage-sensing domain in the activated state1.  This unique toxin is capable of simultaneously inducing both the left shift voltage-dependent activation and a transient resurgent current only in human NaV1.6 channels, among the other TTX-sensitive isoforms2. Cn2 also produced both actions in mouse cerebellar Purkinje neurons and blocked firing at appropriate concentrations2.

NaV1.6 plays an essential role in peripheral sensory neurons, specifically at the distal terminals of mechanosensing fibers innervating the skin and colon. NaV1.6 activation by Cn2 Toxin leads to enhanced response to mechanical stimulus in vivo3. Cn2 Toxin facilitates Nav1.6 early channel opening, and increased persistent and resurgent currents in large-diameter DRG neurons in a unique mechanism of action3.

Cn2 Toxin was described also as a modifier of the neuronal structure and induces apoptosis and reduction of the proliferation and cell survival in experiments performed in F11 mouse neuroblastoma cells4.

The crystal structure of this toxin was determined and it was shown to be a 66 amino acid polypeptide that shares a similar structure with other scorpion toxins acting on sodium channels. It is made of a triple-stranded antiparallel β-sheet and an α-helix, and is stabilized by four disulfide bridges. It contains a hydrophobic core, a hydrophobic patch and a positively charged patch5,6.

Target Nav1.6 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-NaV1.6 (SCN8A) Antibody (#ASC-009)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Phrixotoxin-3 (#STP-720)
Blockers/Antagonists: small molecules
  1. 4,9-Anhydrotetrodotoxin (#T-560)
  2. Tetrodotoxin citrate (#T-550)
Activators/Agonists: peptides/peptide toxins
  1. 1Kα-Pompilidotoxin (#P-172)
  2. BmKI Toxin (#STB-100)
  3. Iota-Conotoxin RXIA (#STI-300)
  4. β-Pompilidotoxin (#P-180)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order