Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Dendrotoxin-K

Venom basic protease inhibitor K, DTX-K

A Potent Blocker of KV1.1 and KV1.2 Channels

Back to product page SDS

Overview

Cat #: D-400
Alternative Name Venom basic protease inhibitor K, DTX-K
Lyophilized Powder yes
Origin Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba).
MW: 6560 Da
Purity: >99% (HPLC)
Effective concentration 100 nM
Sequence AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG-OH
Modifications Disulfide bonds between Cys5-Cys55, Cys14-Cys38, and Cys30-Cys51.
Structure
Molecular formula C294H462N84O75S6.
CAS No.: 119128-61-9
Activity Dendrotoxin-K is a highly selective and potent blocker of voltage-gated K+ channels KV1.1 and Kv1.1-containing heterooligomer.
Accession number P00981
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer (pH 7.5). Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions One week at 4°C or six months at -20°C.
Our bioassay
  • Alomone Labs Dendrotoxin-K inhibits KV1.1 channel currents heterologously expressed in Xenopus oocytes.
    Alomone Labs Dendrotoxin-K inhibits KV1.1 channel currents heterologously expressed in Xenopus oocytes.
    A. Time course at plateau of Dendrotoxin-K (#D-400) action on KV1.1 currents. Current amplitude at plateau was plotted as a function of time. Membrane potential was held at -80 mV and oocytes were stimulated by a 100 ms voltage ramp to -10 mV. 1 nM Dendrotoxin-K (applied for 2 min, green) were perfused during the period marked by the bar, (as indicated) and showed 70-80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 1 nM Dendrotoxin-K (taken from experiment in A).
Scientific background Dendrotoxin-K is isolated from Dendroaspis p.polylepis snake venom by modification of the procedure of Schweitz1 and purified to homogeneity. It blocks mainly KV1.1 (EC50=0.6 nM2) and Kv1.1-containing heterooligomer.
Target KV1.1, Kv1.1-containing heterooligomer.
Peptide Content: 100%
Lyophilized Powder
Image & Title Dendrotoxin-K
Alomone Labs Dendrotoxin-K blocks LVA K+ currents in cultured mouse SGNs.Whole-cell voltage clamp recordings on mouse spiral ganglion neurons (SGNs). Current response during a voltage ramp (between -143 mV and +47 mV, duration 400 ms) before (control) and after bath application of 100 nM Dendrotoxin-K (#D-400). Dendrotoxin-K (DTX-K) blocks the low voltage activated (LVA) K+ current, revealing a small inward current activated at potentials positive to -65 mV (inset).Adapted from Browne, L. et al. (2017) eNeuro 4, e0303. with permission of the Society for Neuroscience.
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-KV1.1 (KCNA1) Antibody (#APC-009)
  2. Anti-KV1.1 (KCNA1) (extracellular) Antibody (#APC-161)
  3. Anti-KV1.1 (KCNA1) (extracellular)-ATTO Fluor-594 Antibody (#APC-161-AR)
  4. Anti-KV1.2 (KCNA2) Antibody (#APC-010)
  5. Anti-KV1.2 (KCNA2) (extracellular) Antibody (#APC-162)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. α-Dendrotoxin (#D-350)
  2. β-Dendrotoxin (#D-360)
  3. γ-Dendrotoxin (#D-370)
  4. δ-Dendrotoxin (#D-380)
  5. Dendrotoxin-I (#D-390)
  6. Hemitoxin (#STH-500)
  7. Hongotoxin-1 (#STH-400)
  8. MCD peptide (#STM-250)
  9. Pandinotoxin Kα (#STP-500)
  10. Tityustoxin-Kα (#STT-360)
  11. Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR)
  12. Urotoxin (#STU-200)

Explorer kits & Research packs

Explorer kits
  1. Shaker (KV1) Channel Blocker Explorer Kit (#EK-107)
  2. KV Channel Blockers for Pain Research Explorer Kit (#EK-380)
  3. K+ Channel Blockers for Pain Research Explorer Kit (#EK-390)
  4. KV1.2 (KCNA2) Channel Antibody and Membrane Fractions Kit (#LK-101)
Research packs
  1. KV1.2 (KCNA2) Channel Basic Research Pack (#ESB-500)
  2. KV1.2 (KCNA2) Channel Premium Research Pack (#ESP-500)
  3. KV1.2 (KCNA2) Channel Deluxe Research Pack (#ESD-500)

Resources

  • The Role of Ion Channels in Neurodegeneration

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • The Role of Ion Channels in Neurodegeneration

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 10 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order