Overview
Cat #:
F-700
Lyophilized Powder yes
Origin Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba snake).
MW: 7026 Da
Purity: >98% (HPLC)
Effective concentration 100 nM - 2 ֲµM.
Sequence RICYSHKASLPRATKTCVENTCYKMFIRTHRQYISERGCGCPTAMWPYQTECCKGDRCNK.
Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58.
Structure
Molecular formula C297N470N92O86S10.
CAS No.: 63653-99-6
Activity FS-2 is an L-type CaV channel blocker1.
References-Activity
- Yasuda, O. et al. (1994) Artery 21, 287.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs FS-2 inhibits CaV1.2 channels heterologously expressed in Xenopus oocytes. 1 µM FS-2 was also used to inhibit high K+ or glucose-induced L-type Ca2+ influx in RIN B insulinoma cells.Left: 500 nM FS-2 (#F-700) inhibits 50% of L-type CaV currents in Xenopus oocytes across the voltage range.
Right: Example traces of Ca2+ current responses to depolarization to +20 mV before and during application of FS-2.
Scientific background
FS-2 is a natural peptidyl toxin isolated from the Dendroaspis p. polylepsis black mamba venom by a modification of the procedure of Schweitz et al.1 and purified to homogenity. FS-2 is an L-type CaV channel blocker.2 The toxin reduced (±)Bay K8644-induced [Ca2+]in increase, in smooth muscle cells as determined by Ca2+ imaging with Fura-2.2 The IC50 for this effect was 23 nM.
FS-2 induced relaxation in pre-constricted rat aorta, pulmonary artery and trachea.3 In addition, it inhibited acetylcholine-induced contractions in guinea pig ileum.
Target L-type Ca2+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations
