Cat #: BLP-PC005
Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only, not for human use
Properties
Sequence
- GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250).
Accession (Uniprot) Number P63250
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 1.2 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-GIRK1 (Kir3.1) Antibody (#APC-005), (1:200).
2. Anti-GIRK1 (Kir3.1) Antibody, preincubated with the control antigen.- Rat brain sections.
Human skin sections (1:200) (Nockemann, D. et al. (2013) EMBO Mol. Med. 5, 1263.).
Last update: 02/01/2024