Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

GsAF-I

β-theraphotoxin-Gr1b, β-TRTX-Gr1b, GsAF1, GsAF-I, GsAFI

A Blocker of TTX-Sensitive NaV and KV11.1 Channels

Back to product page SDS

Overview

Cat #: STG-300
Alternative Name β-theraphotoxin-Gr1b, β-TRTX-Gr1b, GsAF1, GsAF-I, GsAFI
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3707.9 Da
Purity: >98% (HPLC)
Effective concentration 40 nM – 1.3 µM.
Sequence YCQKWLWTCDSERKCCEDMVCRLWCKKRL.
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys25. C-terminal Leu29 amidation.
Structure
Molecular formula C160H245N47O41S7.
Activity GsAF-I is a blocker of TTX-sensitive NaV and hERG1 channels1.
References-Activity
  1. Redaelli, E. et al. (2010) J. Biol. Chem. 285, 4130.
Accession number P61408.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs GsAF-I inhibits NaV1.7 currents in stably transfected HEK293T cells.
    Alomone Labs GsAF-I inhibits NaV1.7 currents in stably transfected HEK293T cells.
    A. Time course of GsAF-I (#STG-300) action on NaV1.7 peak currents. Peak current amplitudes were plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 50 msec from holding potential to 60 mV. 50 nM GsAF-I was perfused as indicated by the horizontal bar (green). B. Superimposed traces of NaV1.7 channel current in the absence (control) and presence of 50 nM (green) GsAF-I perfused during 2.5 min (taken from the experiment in A).
Scientific background

The tetrodotoxin (TTX)-sensitive Na+ channels are differentially distributed in the central and peripheral nervous systems, in skeletal muscle, and in cardiac muscle1.

Several venom-derived peptides are known to modify the gating properties of ion channels, and the study of their mechanisms of action is expected to contribute to the elucidation of the molecular motions associated with channel gating2. Tarantula venoms contain a library of interesting compounds, some of which are exquisite modulators of many types of ion channels. A large number of spider toxins have been demonstrated to modulate NaV channels3.

GsAF-I (also termed β-theraphotoxin-Gr1b) is a peptidyl toxin originally isolated from the venom of Grammostola rosea spider. This toxin is reported to block the following voltage-gated Na+ channels: NaV1.1, NaV1.2, NaV1.3, NaV1.4, NaV1.6 and NaV1.7 with respective IC50 values of 0.4, 0.6, 1.3, 0.3, 1.2 and 0.04 µM. In addition, the toxin blocks the hERG1 isoform with an IC50 value of 4.8 µM4.

Target TTX-sensitive NaV, KV11.1 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. µ-Conotoxin PIIIA (#STC-400)
  2. µ-Conotoxin SIIIA (#STC-450)
  3. GsMTx-4 (#STG-100)
  4. ProTx-II (#STP-100)
  5. Anti-NaV1.7 (SCN9A) Antibody (#ASC-008)
  6. Anti-NaV1.7 (SCN9A)-ATTO Fluor-633 Antibody (#ASC-008-FR)
  7. Anti-KCNH2 (erg1) Antibody (#APC-016)
  8. Anti-KCNH2 (HERG) (extracellular) Antibody (#APC-109)
  9. hERG and hERG-Related Channel Antibody Explorer Kit (#AK-222)
  10. hERG Related Channel Modulator Explorer Kit (#EK-109)
  11. TTX-Sensitive NaV Channel Antibody Explorer Kit (#AK-224)
  12. TTX-Sensitive NaV Channel Blocker Explorer Kit (#EK-105)
  13. NaV Channel Activator Explorer Kit (#EK-203)

Resources

  • NaV1.7 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • NaV1.7 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order