Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Activators

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Hj2a Toxin

Delta-buthitoxin-Hj2a, Delta-BUTX-Hj2a

A Potent Activator of Nav1.1, Nav1.4, Nav1.5, Nav1.6 and Nav1.7 Channels.

Back to product page SDS

Overview

Cat #: STH-555
Alternative Name Delta-buthitoxin-Hj2a, Delta-BUTX-Hj2a
Lyophilized Powder yes
Origin Hottentotta judaicus (Black scorpion) (Buthotus judaicus)
Source Synthetic peptide
MW: 7118 Da
Purity: >98% (HPLC)
Form Lyophilized Powder
Effective concentration 20-500 nM
Sequence GRDAYIADDKNCVYTCAKNSYCNNECTKNGAESGYCQWLGKYGNGCWCKNLPDKVPIRIPGPCR-NH2
Modifications Disulfide bonds between: Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48
Arg64 - Arginine amide
Molecular formula C304H457N89O94S8
Activity Hj2a is an agonist of NaV1.1 which presents dual α/β activity by modifying both the activation and inactivation properties of the channel1.
Accession number P0DQN9
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
Solubility Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles.
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C.
Scientific background

δ-buthitoxin-Hj2a (Hj2a) is a peptidyl toxin originally isolated from the venom of the scorpion, Hottentotta jayakari. Hj2a acts as a voltage-gated sodium (Nav) 1.1 channel activator, but it also harbors promiscuous activity towards multiple human NaV channel subtypes. Hj2a is unique in that it exhibits a dual α/β mode of action by modifying both the inactivation (α-toxin activity) and activation (β-toxin activity) properties of the NaV1.1 channel1.

NaV channels are involved in a wide array of physiological processes and play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. In particular, the NaV1.1 channel is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in the NaV1.1 channel were shown to be associated with Dravet syndrome (DS), a severe form of pediatric epilepsy. Selective modulators of the NaV1.1 channel can be useful therapeutics for DS treatment since they target the underlying molecular deficit. The unusual dual mode of action of Hj2a provides an alternative approach for the development of selective NaV1.1 channel modulators for the treatment of DS1,2.

Target NaV1.1, Voltage-gated Na+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-NaV1.6 (SCN8A) Antibody (#ASC-009)
  2. Anti-NaV1.7 (SCN9A) Antibody (#ASC-008)
  3. Anti-SCN1A (NaV1.1) Antibody (#ASC-001)
  4. Anti-SCN4A (NaV1.4) Antibody (#ASC-020)
  5. Guinea pig Anti-NaV1.7 (SCN9A) Antibody (#ASC-008-GP (formerly AGP-057))
  6. Guinea pig Anti-SCN1A (NaV1.1) Antibody (#ASC-001-GP (formerly AGP-043))

Pharmacological tools

Blockers/Antagonists: small molecules
  1. Tetrodotoxin citrate (#T-550)
  2. Tetrodotoxin citrate free (#T-500)
Activators/Agonists: peptides/peptide toxins
  1. 1Kα-Pompilidotoxin (#P-172)
  2. 1Kβ-Pompilidotoxin (#P-182)
  3. Hj1a Toxin (#STH-450)
  4. Hm1a Toxin (#STH-601)
  5. Hm1b Toxin (#STH-655)
  6. α-Pompilidotoxin (#P-170)
Activators/Agonists: small molecules
  1. NaV1.1-Compound 3a (#CMN-002)
  2. Veratridine (#V-110)
Modulators: peptides/peptide toxins
  1. ATX-II (#STA-700)

Explorer kits & Research packs

Explorer kits
  1. NaV Channel Activator Explorer Kit (#EK-203)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order