Overview
Cat #:
STH-250
Alternative Name Pi-theraphotoxin-Hm3a, Pi-TRTX-Hm3a
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4287.1 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 1-200 nM.
Sequence EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV.
Modifications Disulfide bonds between Cys3- Cys18, Cys10- Cys23, Cys17- Cys33.
Molecular formula C186H290N56O49S6.
Activity Hm3a Toxin acts as a potent ASIC1a channel blocker with an IC50 value of 1-2 nM and ASIC1b channel activator with an EC50 value of 46.5 nM1.
References-Activity
- Er, S.Y. et al. (2017) Neuropharmacology 127, 185.
Accession number C0HKD0.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g for 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Hm3a Toxin inhibits ASIC1a channels expressed in Xenopus oocytes.A. Representative time course of Hm3a Toxin (#STH-250) inhibition of ASIC1a currents. Membrane potential was held at -80 mV, current was elicited every 50 sec by a transient application of pH 5.5 and inhibited by a 4 min application of 1 nM Hm3a Toxin, as indicated. B. Superimposed traces of ASIC1a currents upon application of control and of 1 nM Hm3a Toxin (taken from the experiment in A).
Scientific background
Hm3a is a 37-amino acid peptide toxin originally isolated from the venom of Togo starburst tarantula (Heteroscodra maculata) and acts as a potent ASIC1a channel blocker with an IC50 value of 1-2 nM and ASIC1b channel activator with an EC50 value of 46.5 nM1. Studies reveal that Glu177 and Arg175 in the palm region opposite α-helix 5 play an important role in the interaction between Hm3a and ASIC1 and contribute to the subtype-dependent effects of the peptide. Hm3a is a useful tool for studying ASICs1.
Acid-sensing ion channels (ASICs) are voltage-independent proton-gated amiloride sensitive sodium channels, belonging to the DEG/ENaC gene family, activated by a drop in extracellular pH. ASIC1a is a promising therapeutic target1,2.
Target ASIC1a and ASIC1b
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/04/2024
Specifications
Citations
Citations
