Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Neurotrophins › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

human BDNF-Biotin

Biotin Labeled human BDNF for Qdot Labeling

Back to product page SDS

Overview

Cat #: B-250-B
Lyophilized Powder yes
Origin Recombinant, E. coli
Source Modified recombinant protein
MW: ~28 kDa
Purity: >98%
Effective concentration ED50 = 220 pM.
Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
Label Sulfo-NHS-LC-Biotin (~556 Da) was used for labeling human BDNF. The extent of labeling is 1-2 molecules of biotin per one molecule of human BDNF. The biotin is covalently conjugated to the N-terminus or to lysine residues present in human BDNF.
Structure
Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2.
References-Activity
  1. Tolkovsky, A. (1997) Trends Neurosci. 20, 1.
  2. Jing, S. et al. (1992) Neuron 9, 1067.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • BDNF co-localizes with TrkB in mouse cerebellum region.
    BDNF co-localizes with TrkB in mouse cerebellum region.
    A. Fixed brain sections were incubated with human BDNF-Biotin (#B-250-B) followed by Streptavidin-Cy3. B.  Same sections were incubated with Anti-TrkB (extracellular)-ATTO Fluor-488 Antibody (#ANT-019-AG). C. Merge of A and B reveals co-localization in the Purkinje layer (P). TrkB positive cells (green) with BDNF binding (red, arrow) is seen.
  • Alomone Labs human BDNF-Biotin induces ERK1/2 MAPK phosphorylation in transfected HEK-293 cells as BDNF.
    Alomone Labs human BDNF-Biotin induces ERK1/2 MAPK phosphorylation in transfected HEK-293 cells as BDNF.
    Transfected cells were serum depleted for 2 h, 3 days post-transfection and then challenged with 1 and 10 ng/ml Recombinant human BDNF protein (#B-250) or 1, 10 and 100 ng/ml human BDNF-Biotin (#B-250-B) for 10 min. The cell proteins were resolved by SDS-PAGE and detected with anti-phospho-ERK1/2.
  • Alomone Labs human BDNF-Biotin induces ERK1/2 MAPK phosphorylation in mouse cortical neurons as BDNF.
    Alomone Labs human BDNF-Biotin induces ERK1/2 MAPK phosphorylation in mouse cortical neurons as BDNF.
    Mouse cortical neurons were starved for 4 h and then challenged with 50 ng/ml Recombinant human BDNF protein (#B-250) or human BDNF-Biotin (#B-250-B) for 30 min. 20 µg of the cell protein lysate were resolved by SDS-PAGE and detected with anti-phospho-ERK1/2 and anti-tubulin (the experiment was performed and the picture was kindly provided by Dr. Eran Perlsson, the Dept. of Pharmacology and Physiology, Tel-Aviv University).
  • Alomone Labs human BDNF-Biotin binds TrKB receptors in living and stably transfected HEK293 cells and is displaced by un-labeled human BDNF.
    Alomone Labs human BDNF-Biotin binds TrKB receptors in living and stably transfected HEK293 cells and is displaced by un-labeled human BDNF.
    Living cells were incubated with 100 ng/ml human BDNF-Biotin (#B-250-B) in the absence (A-D) and presence (E,F) of 2 µg/ml Recombinant human BDNF protein (#B-250). Pictures were taken in early stages of the experiment (A-B) as well as in late stages (C-D) in order to show the accumulation effect of human BDNF-Biotin. human BDNF-Biotin was visualized using StrepAvidin-AlexaFluor-594. Similar results were observed using 10 ng/ml human BDNF-Biotin (data not shown).
Scientific background

Few examples in the literature emphasize the importance of using BDNF-biotin in living cells experiments. Pardridge, W.M. et al. demonstrated that the delivery of BDNF to the brain is non-existent owing to the combined effects of neglible blood brain barrier (BBB) transport and rapid systemic clearance1. The brain delivery of BDNF may be increased by conjugating biotinylated BDNF to BBB drug delivery vectors, such as neutral avidin conjugated to murine monoclonal antibody to the rat transferrin receptor1. Zhang, Y. and Pardridge, W.M. further showed that when BDNF is formulated to enable transport across the BBB, the intravenous administration of BDNF results in the reduction in stroke volume and improvement in functional outcome2.

Du, J. et al. detected by using BDNF-biotin the ligand-induced TrkB internalization in cultured hippocampal neurons3.

Bhattacharyya, A. et al. showed in mature sciatic nerves, that biotinylated BDNF activated Trk receptors function as rapid retrograde signal carriers to execute remote responses to target-derived neurotrophins4.

Song, X.Y. et al. proved that exogenous BDNF-biotin is transported by the peripheral nerves following injection into the rat footpad and can be found in the sciatic nerves in fibres and vesicles5. Their data suggest that peripherally applied BDNF may have therapeutic effects on injured spinal cord. Xie, W. et al. followed the trafficking of QD-BDNF (Quantum Dot-BDNF) after its internalization at the axon terminal6. Their result showed that QD-BDNF could be used to track the movement of exogenous BDNF in neurons over long distances and to study the signaling organelles that contain BDNF6.

Peptide Content: 100%
Lyophilized Powder
Image & Title

human BDNF-Biotin
TrkB binds to BDNF at the plasma membrane.Live TIRF imaging of TrkB-ACP-488 and labeled BDNF co-movement in HEK293T (HEK). Cells treated with streptavidin-647-labeled human BDNF-Biotin (#B-250-B) for 5 minutes and imaged at 8 fps. Arrowhead marks co-localized TrkB-BDNF particle. Scale bar = 2 µm. Right: color trace shows movement trajectory of TrkB-ACP-488 and BDNF-647 particles over time (blue- start, red- end of trajectory) Scale bar = 1 µm.Unpublished data from Zahavi, E.E. et al. (2018) Sci. Signal. 11, eaao4006. Figure generously provided by Dr. Eran Perlson, Dept. of Physiology and Pharmacology, Tel-Aviv University, Tel-Aviv, Israel.

For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • BDNF Positive Control for Western Blot (#PCP-B250), is a recombinant, highly purified BDNF protein in a ready-to-use single reagent format. This makes it a good positive control by loading it alongside the experimental lysates or samples in a SDS-PAGE. This product enables to check whether the primary and secondary antibodies are working as expected and also visualize a reference of the expected molecular weight of the target protein.

    BDNF Positive Control for Western Blot (#PCP-B250)

Related Products

Antibodies

  1. Anti-BDNF Antibody (#ANT-010)
  2. Guinea pig Anti-BDNF Antibody (#ANT-010-GP (formerly AGP-021))
  3. Anti-proBDNF Antibody (#ANT-006)
  4. Anti-proBDNF-ATTO Fluor-488 Antibody (#ANT-006-AG)
  5. Anti-TrkB (extracellular) Antibody (#ANT-019)
  6. Anti-TrkB (extracellular)-FITC Antibody (#ANT-019-F)
  7. Anti-p75 NGF Receptor (extracellular) Antibody (#ANT-007)

Neurotrophins/Growth factors

  1. Recombinant human BDNF protein (#B-250)
  2. Recombinant human BDNF proDomain protein (#B-245)
  3. Recombinant human proBDNF protein (#B-257)
  4. Recombinant human proBDNF (cleavage resistant) protein (#B-256)
  5. Recombinant mouse proBDNF protein (#B-240)
  6. Recombinant mouse proBDNF (cleavage resistant) protein (#B-243)

Pharmacological tools

Blockers/Antagonists: small molecules
  1. ANA-12 (#A-215)
  2. AZD-1332 (#A-495)
  3. GNF 5837 (#G-145)
  4. GW-2580 (#G-255)
  5. PF-06439015 (#P-355)
Blockers/Antagonists: proteins
  1. Human TrkB-Fc Chimera (#RPC-001)

Explorer kits & Research packs

Explorer kits
  1. Neurotrophic Factor Explorer Kit (#EK-500)
Research packs
  1. BDNF Basic Research Pack (#ESB-600)
  2. BDNF Premium Research Pack (#ESP-600)
  3. BDNF Deluxe Research Pack (#ESD-600)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order