Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Neurotrophins › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant human BDNF proDomain protein

Human Brain-Derived Neurotrophic Factor proDomain, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: B-245
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 12.4 kDa
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Sequence MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR.
Structure
Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
References-Activity
  1. Tolkovsky, A. (1997) Trends Neurosci. 20, 1.
  2. Jing, S. et al. (1992) Neuron 9, 1067.
  3. Acheson, A. et al. (1995) Nature 374, 450.
  4. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146.
  5. Hyman, C. et al. (1991) Nature 350, 230.
  6. Friedman, B. et al. (1995) J. Neurosci. 15, 1044.
  7. Meyer, M. et al. (1992) J. Cell Biol. 119, 45.
  8. Koliatsos, V.E. et al. (1993) Neuron 10, 359.
  9. Teng, H.K. et al. (2005) J. Neurosci. 25, 5455.
  10. Woo, N.H. et al. (2005) Nat. Neurosci. 8, 1069.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 10 µg/ml.
Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • Western blot analysis of purified proteins:Recombinant human proBDNF protein (#B-257), (lanes 1 and 4)Recombinant human BDNF proDomain protein (#B-245), (lanes 2 and 5)Recombinant human BDNF protein (#B-250), (lanes 3 and 6)
    Western blot analysis of purified proteins:
    Recombinant human proBDNF protein (#B-257), (lanes 1 and 4)
    Recombinant human BDNF proDomain protein (#B-245), (lanes 2 and 5)
    Recombinant human BDNF protein (#B-250), (lanes 3 and 6)
    1-3. Guinea pig Anti-proBDNF Antibody (#AGP-032), (1:280)
    4-6. Guinea pig Anti-BDNF Antibody (#AGP-021), (1:280)
    proBDNF is recognized both by Anti-proBDNF and Anti-BDNF antibodies as a monomer at ~ 26 kDa.
    BDNF proDomain is recognized by Anti-proBDNF, but not by Anti-BDNF antibody, at ~ 12.4 kDa.
    BDNF is recognized by Anti-BDNF, but not by Anti-proBDNF antibody, as a monomer at ~ 13.5 kDa.
Scientific background

BDNF regulates neuronal survival, differentiation, and synaptic plasticity. It affects the release of excitatory neurotransmitters and has been found to affect cardiovascular development and function.1 Like many other neurotrophins, BDNF is a cleavage product of the BDNF precursor, proBDNF. This precursor may be cleaved by various proteases, intracellularly by furin and extracellularly by several proteases including prohormone convertases, plasminogen activator, MMP-3 and MMP-7 in vitro.2,3

Two different trans-membrane receptor proteins mediate BDNF and proBDNF signal transduction: the TrkB, and the pan-neurotrophic receptor p75NTR.4 ProBDNF has been demonstrated to induce TrkB phosphorylation in vitro and to bind p75NTR and sortilin to promote apoptosis.5,6

In many cases, the full prodomain region derived from the protein precursor has biological functions, for instance; the prodomain of the transforming growth factor β (TGFβ) affects the dimerization and folding as well as the activity of the mature proteins via non-covalent association. The propeptide of the bone morphogenetic proteins BMP-4 and BMP-7 regulates the diffusion and distribution of these growth factors within the extracellular matrix.7,8 The prodomain region of the BDNF precursor plays an important role in regulating its intracellular trafficking to secretory pathways.9 However, the role of the full BDNF-prodomain, which is a product of proteolytic cleavage of proBDNF, is not clearly understood. Furthermore, binding competition studies suggest that binding sites for BDNF prodomain are located in the tunnel of the ten-bladed b-propeller domain of sortilin.10

Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Recombinant human BDNF protein (#B-250)
  2. Recombinant human proBDNF protein (#B-257)
  3. Recombinant human proBDNF (cleavage resistant) protein (#B-256)
  4. Anti-proBDNF Antibody (#ANT-006)
  5. Anti-proBDNF-ATTO Fluor-488 Antibody (#ANT-006-AG)
  6. Neurotrophic Factor Explorer Kit (#EK-500)
  7. human BDNF-Biotin (#B-250-B)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 10 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order