Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Neurotrophins › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant human BDNF protein

Brain-Derived Neurotrophic Factor

Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: B-250
Alternative Name Brain-Derived Neurotrophic Factor
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 27 kDa
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Effective concentration ED50 = 220 pM.
Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
Structure
Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8.
References-Activity
  1. Tolkovsky, A. (1997) Trends Neurosci. 20, 1.
  2. Jing, S. et al. (1992) Neuron 9, 1067.
  3. Acheson, A. et al. (1995) Nature 374, 450.
  4. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146.
  5. Hyman, C. et al. (1991) Nature 350, 230.
  6. Friedman, B. et al. (1995) J. Neurosci. 15, 1044.
  7. Meyer, M. et al. (1992) J. Cell Biol. 119, 45.
  8. Koliatsos, V.E. et al. (1993) Neuron 10, 359.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 1 µg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • Alomone Labs BDNF induces ERK1/2 MAPK phosphorylation of the neurotrophin receptor tyrosine kinase B (TrkB) transfected HEK-293 cells.
    Alomone Labs BDNF induces ERK1/2 MAPK phosphorylation of the neurotrophin receptor tyrosine kinase B (TrkB) transfected HEK-293 cells.
    Transfected cells were serum depleted for 2 h 3 days post-transfection and then challenged with 20 ng/ml Recombinant human BDNF protein (#B-250) for 10 min. The cell proteins were resolved by SDS-PAGE and detected with anti-TrkB and anti-phospho-ERK1/2.
Scientific background

Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophic growth factors, and shares high sequence homology with NGF, NT-3 and NT-4/5.1,2 BDNF is found in neurons of the central nervous system. It is expressed predominantly in hippocampus, cortex, and amygdaloid complex.3

The synthesis of BDNF is subject to regulation by neuronal activity and specific transmitter systems.4

BDNF binds to p75NTR, the neurotrophin receptor, and may initiate programmed cell death by acting through this receptor.5 Signal transduction is activated by the dimerization and autophosphorylation of the TrkB receptor.6

BDNF supports the survival of primary sensory neurons,7 retinal ganglion cells, basal forebrain cholinergic neurons,8 and mesencephalic dopaminergic neurons in vitro.9 BDNF prevents death of cultured rat spinal motor neurons,10 and rescues substantial numbers of motor neurons after lesioning of the neonatal sciatic or facial nerve.11 Expression is switched on in Schwann cells following peripheral nerve lesion.11 BDNF also inhibits the normal cell death of embryonic chick motor neurons.12

BDNF acts in concert with other factors and neurotrophins. The biological activities of BDNF and NT-3 (neurotrophin-3) are additive, and BDNF also interacts with LIF.13

The effects of BDNF on motor neurons raise the possibility that it may be useful in treating patients with motor neuropathies and Amyotrophic Lateral Sclerosis (ALS).14

Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • BDNF Positive Control for Western Blot (#PCP-B250), is a recombinant, highly purified BDNF protein in a ready-to-use single reagent format. This makes it a good positive control by loading it alongside the experimental lysates or samples in a SDS-PAGE. This product enables to check whether the primary and secondary antibodies are working as expected and also visualize a reference of the expected molecular weight of the target protein.

    BDNF Positive Control for Western Blot (#PCP-B250)

Related Products

Antibodies

  1. Anti-BDNF Antibody (#ANT-010)
  2. Guinea pig Anti-BDNF Antibody (#ANT-010-GP (formerly AGP-021))
  3. Anti-proBDNF Antibody (#ANT-006)
  4. Anti-proBDNF-ATTO Fluor-488 Antibody (#ANT-006-AG)
  5. Anti-p75 NGF Receptor (intracellular) Antibody (#ANT-011)
  6. Anti-TrkB (extracellular)-ATTO Fluor-488 Antibody (#ANT-019-AG)
  7. Anti-TrkB (extracellular)-FITC Antibody (#ANT-019-F)

Neurotrophins/Growth factors

  1. human BDNF-Biotin (#B-250-B)
  2. Recombinant human BDNF proDomain protein (#B-245)
  3. Recombinant human BDNF proDomain (Val66Met) protein (#B-445)
  4. Recombinant human proBDNF protein (#B-257)
  5. Recombinant human proBDNF (cleavage resistant) protein (#B-256)
  6. Recombinant mouse proBDNF protein (#B-240)

Pharmacological tools

Blockers/Antagonists: small molecules
  1. ANA-12 (#A-215)
  2. AZD-1332 (#A-495)
  3. GNF 5837 (#G-145)
  4. GW-2580 (#G-255)
  5. PF-06439015 (#P-355)
Blockers/Antagonists: proteins
  1. Human TrkB-Fc Chimera (#RPC-001)

Explorer kits & Research packs

Explorer kits
  1. Neurotrophic Factor Explorer Kit (#EK-500)
Research packs
  1. BDNF Basic Research Pack (#ESB-600)
  2. BDNF Premium Research Pack (#ESP-600)
  3. BDNF Deluxe Research Pack (#ESD-600)

Resources

  • NGF: One Molecule, Multiple Functions
  • BDNF – Second Best?
  • p75NTR – The Promiscuous Receptor
  • The Role of p75NTR in Cancer
  • NT-3 and NT-4 at the Nerve Center of Neurotrophic Research

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • NGF: One Molecule, Multiple Functions

  • BDNF – Second Best?

  • p75NTR – The Promiscuous Receptor

  • The Role of p75NTR in Cancer

  • NT-3 and NT-4 at the Nerve Center of Neurotrophic Research

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 1 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order