Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Cytokines and Receptors › Neuropoietic Cytokines and Receptors › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant human Cardiotrophin-1 protein

CT-1

human Cardiotrophin-1, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: C-200
Alternative Name CT-1
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 21.1 kDa
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Sequence SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Activity Cardiotrophin-1 is a member of the neuropoietic cytokine family which enhances the survival of ciliary and dopaminergic neurons through the interaction with the gp130 receptor. Cardiotrophin-1 induces cardiac myocyte hypertrophy and has been shown to promote the survival of both embryonic and neonatal rat ventricular muscle cells1-3.
References-Activity
  1. Pennica, D. et al. (1995) Proc. Natl. Acad. Sci U.S.A. 92, 1142.
  2. Cheng, J.G. et al. (1997) J. Neurochem. 69, 2278.
  3. Sheng, Z. et al. (1996) Development 122, 419.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 1 µg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • Alomone Labs Recombinant human Cardiotrophin-1 protein induces ERK1/2 MAPK phosphorylation.
    Alomone Labs Recombinant human Cardiotrophin-1 protein induces ERK1/2 MAPK phosphorylation.
    3T3-L1 cells were grown to 70% confluence, serum starved for 3 h and then stimulated with various concentrations of Recombinant human Cardiotrophin-1 protein (#C-200) for 10 min. The cell proteins were resolved by SDS PAGE and probed with anti-Phospho-ERK 1/2 MAPK.
Scientific background

Cardiotrophin-1 is a member of the neuropoietic cytokine family (LIF, CNTF, OSM IL-11, IL-6). Cardiotrophin-1 is a strong inducer of cardiac hypertrophy, exerts cardio-protective effects and plays a role in neuronal growth and differentiation.1,2

In neonatal rat, Cardiotrophin-1 has been shown to promote cardiac myocyte survival and to enhance embryonic myocyte proliferation during cardiac chamber development.3 Cardiotrophin-1 increases angiotensinogen gene transcription and induces VEGF expression in cardiac myocytes.4,5 It also induces vessel growth during cardiac remodelling, an effect that may contribute to its cardio-protective properties.

In humans, a recent report showed an increase in circulating Cardiotrophin-1 in heart failure.6 A strong correlation between the increased Cardiotrophin-1 and the severity of left ventricular systolic dysfunction was found.7

Cardiotrophin-1 is a very potent neurotrophic factor for motoneurons in long-term culture and protects neonatal rat motoneurons from axotomy-induced cell death.2,8 It was able to modulate the synthesis of specific neurotransmitters by cultured neuronal cells,9 and to promote the survival of rat dopaminergic and chick ciliary neurons.10 Recently, the potential for neuroprotection by Cardiotrophin-1 was investigated in animal models characterized by a prominent axonal degeneration.11-13

Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-CNTF Antibody (#ANT-031)
  2. Anti-GP130 (extracellular) Antibody (#ALR-023)

Neurotrophins/Growth factors

  1. Recombinant human CNTF protein (#C-240)
  2. Recombinant rat CNTF protein (#C-245)
  3. Recombinant human LIF protein (#L-200)

Explorer kits & Research packs

Explorer kits
  1. Neurotrophic Factor Explorer Kit (#EK-500)

Resources

  • Survival and Phagocytic Effects of CNTF

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Survival and Phagocytic Effects of CNTF

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 5 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order