Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Growth Factors and Receptors › Epidermal Growth Factor › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant human EGF protein

Epidermal Growth Factor, Urogastrone, Beta Urogastrone, URG

Human Epidermal Growth Factor, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: E-100
Alternative Name Epidermal Growth Factor, Urogastrone, Beta Urogastrone, URG
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 6.2 kDa
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Effective concentration EC50 = 20 pg/ml.
Sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
Structure
Activity EGF is a potent growth factor that stimulates both in vitro and in vivo the proliferation of various epidermal and epithelial cells1. Fibroblasts are also stimulated in vitro by EGF2,3.
References-Activity
  1. Bell, G.I. et al. (1986) Nucleic Acids Res. 14, 8427.
  2. Carpenter, G. and Zendegui J.G. (1986) Exp. Cell Res. 164, 1.
  3. Herbst, R.S. (2004) Int. J. Radiat. Oncol. Biol. Phys. 59, S21.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 1 μg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • Alomone Labs Recombinant human EGF protein promotes the phosphorylation of ERK1/2 in preadipocyte 3T3-L1 cells.
    Alomone Labs Recombinant human EGF protein promotes the phosphorylation of ERK1/2 in preadipocyte 3T3-L1 cells.
    Cells were stimulated with increasing concentrations of Recombinant human EGF protein (#E-100) for 6 min. The cells were subjected to western blot analysis and the activation of ERK1/2 was determined using anti-phospho-ERK1/2 antibody.
Scientific background

The epidermal growth factor (EGF) family is important in regulating growth, maturation, function, and maintenance in epithelial tissues (particularly the mammary glands and gastrointestinal tract) and the nerve system. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro1 and of some fibroblasts in cell culture2-3.

The EGF family is comprised of 13 members, which are all membrane-anchored proteins, in addition to their properties as ligands that activate epidermal growth factor receptor (EGFR), bearing tyrosine kinase activity4.

The EC50 of EGF is 0.05-5.0 ng/ml using Balb/MK cells5, and its importance as a potential therapeutic agent has been extended by the realization that EGF-like activities may be involved in wound healing and could alter cell growth in cancer3,6. The risk of cancer is increased by EGF and therefore, inhibiting it decreases cancer risk. There are two classes of inhibitors: the small-molecule EGFR tyrosine kinase inhibitors (SMTKIs) and monoclonal antibodies to the receptors7.

EGF is also a magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Defects in EGF are the cause of hypomagnesemia type 4 (HOMG4), also known as renal hypomagnesemia normocalciuric. HOMG4 is a disorder characterized by massive renal hypomagnesemia and normal levels of serum calcium and calcium excretion. Clinical features include seizures, mild-to moderate psychomotor retardation, and brisk tendon reflexes8.

Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Neurotrophins/Growth factors

  1. Recombinant human FGF-b protein (#F-170)
  2. Recombinant human CNTF protein (#C-240)
  3. Recombinant rat IGF-I protein (#I-200)

Pharmacological tools

Blockers/Antagonists: small molecules
  1. Genistein (#G-300)
  2. PD 153035 (#P-360)
  3. Tyrphostin AG 1478 (#T-320)
  4. 17-AAG (#A-580)
  5. Trichostatin A (#T-300)
  6. Radicicol (#R-370)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order