Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Heparin-Binding Growth Factors › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant human Pleiotrophin protein

PTN

Human Pleiotrophin, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: P-150
Alternative Name PTN
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 15.4 kDa
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Effective concentration EC50 = ~0.65-6.5 pM.
Sequence MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD.
Activity Pleiotrophin is a member of the heparin-binding neurotrophic factor family. It is a developmentally regulated neurotrophic factor which promotes neurite outgrowth, axonal guidance and synaptogenesis1-4.
References-Activity
  1. Rauvala, H. and Peng, H.B. (1997) Prog. Neurobiol. 52, 127.
  2. Li, Y.S. et al. (1990) Science 250, 1690.
  3. Asai, T. et al. (1997) Biochem. Biophys. Res. Commun. 236, 60.
  4. Owada, K. et al. (1999) J. Neurochem. 73, 2084.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 1 µg/0.1 ml.
BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • The activity was determined by the ability to enhance neurite outgrowth of cerebral cortical neurons of E10 chick embryos.
Scientific background

Pleiotrophin (PTN), is a heparin-binding neurotrophic factor. Cells that express either PTN or PTN mRNA include osteoblasts, fetal chondrocytes,1 astrocytes, oligodendroglia, neurons,2 Schwann cells,3 keratinocytes of the stratum basale,3 and selected tumor cell lines.4,5 The expression of PTN increases during the process of brain embryogenesis and reaches maximum levels at time of birth.

The role of PTN in neurogenesis and neural plasticity has been revealed by various studies. Embryonic cortical neurons adhere to and extend neurites on PTN coated substratum.6 PTN also induces, in vitro, migration of osteoblasts. 7 PTN coated membrane enhances neuronal migration by haptotaxis.8 PTN bound to agarose beads induces clustering of acetylcholine receptors on embryonic myoblasts.9

PTN is expressed in the CA1 region of rat hippocampus in an activity-dependent manner, and is suggested to be involved in the regulation of synaptic plasticity in the hippocampus.10

Transfection with PTN cDNA, transforms murine 3T3 fibroblasts into cells that form extensively metastasizing tumors in nude mice.11 PTN is highly expressed in choriocarcinoma, melanoma and, prostate carcinoma. Serum PTN increase in patients with pancreatic and colon carcinomas.12

After focal forebrain ischemia, PTN is expressed in astrocytes, OX-42 positive macrophages, and endothelial cells in areas of developing neovascularization.13 PTN is also deposited in senile plaques in Alzheimer's disease and Down's syndrome.14

Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Recombinant human FGF-b protein (#F-170)
  2. Neurotrophic Factor Explorer Kit (#EK-500)

Resources

  • Novel Neurotrophic Factors

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Novel Neurotrophic Factors

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 5 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order