Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Neurotrophins › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant human proBDNF protein

proBrain-Derived Neurotrophic Factor

Human proBrain-Derived Neurotrophic Factor, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: B-257
Alternative Name proBrain-Derived Neurotrophic Factor
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 51.78 kDa
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Effective concentration 0.1-10 nM
Sequence MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (shown in bold is the prodomain).
Structure
Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
References-Activity
  1. Tolkovsky, A. (1997) Trends Neurosci. 20, 1.
  2. Acheson, A. et al. (1995) Nature 374, 450.
  3. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146.
  4. Hyman, C. et al. (1991) Nature 350, 230.
  5. Friedman, B. et al. (1995) J. Neurosci. 15, 1044.
  6. Meyer, M. et al. (1992) J. Cell Biol. 119, 45.
  7. Koliatsos, V.E. et al. (1993) Neuron 10, 359.
  8. Teng, H.K. et al. (2005) J. Neurosci. 25, 5455.
  9. Woo, N.H. et al. (2005) Nat. Neurosci. 8, 1069.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 10 µg/ml. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • Alomone Labs Recombinant human proBDNF protein mediates neurite outgrowth in TrkB transfected PC12 cells.
    Alomone Labs Recombinant human proBDNF protein mediates neurite outgrowth in TrkB transfected PC12 cells.
    Cells were transiently transfected with TrkB/pcDNA3 containing the green fluorescence protein (GFP) as a reporter. One day post transfection, the cells were stimulated with 20 ng/ml Recombinant human proBDNF protein (#B-257) or 10ng/ml Recombinant human BDNF protein (#B-250). Development of neurites was visualized after 6 days using bright light microscopy.
  • Alomone Labs Recombinant human proBDNF protein mediates ERK1/2 activation in TrkB transfected HEK293 cells.
    Alomone Labs Recombinant human proBDNF protein mediates ERK1/2 activation in TrkB transfected HEK293 cells.
    Transfected cells were serum depleted for 2 h and then challenged with or without Recombinant human proBDNF (cleavage resistant) protein (#B-256), Recombinant human proBDNF protein (#B-257), Recombinant mouse proBDNF (cleavage resistant) protein (#B-243) or Recombinant human BDNF protein (#B-250) for 10 min. Cell proteins were resolved by SDS-PAGE and detected with anti-phospho-ERK1/2.
Scientific background

BDNF is a neurotrophic factor produced by proteolytic cleavage of its precursor, proBDNF. The biologically relevant form of the protein was thought to be the mature form, BDNF.1 The actions of BDNF are mediated via the binding to TrkB or p75.2,3

The precursor form was thought to be important for the correct folding, secretion and trafficking of the mature protein. A single-nucleotide polymorphism (Val66 to Met) in the pro-domain of the human BDNF gene impairs intracellular trafficking and regulated secretion of BDNF in primary cortical neurons and neurosecretory cells but not in endothelial and vascular cells.4 This has been shown to affect memory and lead to abnormal hippocampal function in humans.5

The finding that proBDNF and not mature BDNF is the preferred ligand for p75, has ushered in a new era which reexamines the biological roles of the two forms.6 Some biological roles for proBDNF have been proposed. It has been shown to be a pro-apoptotic ligand for sympathetic neurons7 expressing both p75 and sortlin, and to be involved in LTD8. On the other hand, it has also been shown to elicit prototypical TrkB responses in biological assays, such as TrkB tyrosine phosphorylation, and activation of ERK1/2.9

In brain homogenates a mixture of both, proBDNF and mature BDNF has been found10,11 and in cortical neurons secretion of proBDNF has been shown.7 Binding of both proBDNF and mature BDNF to TrkB has been proposed to be via the R103 residue in the mature portion.9

Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • proBDNF Positive Control for Western Blot (#PCP-B257), is a recombinant, highly purified proBDNF protein in a ready-to-use single reagent format. This makes it a good positive control by loading it alongside the experimental lysates or samples in a SDS-PAGE. This product enables to check whether the primary and secondary antibodies are working as expected and also visualize a reference of the expected molecular weight of the target protein.

    proBDNF Positive Control for Western Blot (#PCP-B257)

Related Products

  1. Anti-p75 NGF Receptor (extracellular) Antibody (#ANT-007)
  2. Anti-proBDNF Antibody (#ANT-006)
  3. Recombinant human BDNF proDomain protein (#B-245)
  4. Recombinant human BDNF protein (#B-250)
  5. Recombinant human proBDNF (cleavage resistant) protein (#B-256)
  6. Neurotrophic Factor Explorer Kit (#EK-500)
  7. human BDNF-Biotin (#B-250-B)

Resources

  • proNGF and proBDNF: The Alter Egos

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • proNGF and proBDNF: The Alter Egos

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 5 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order