Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ca2+ Channels › Voltage-Gated Ca2+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Huwentoxin-XVI

HWTX-XVI

A Potent and Reversible Blocker of CaV2.2 Channels

Back to product page SDS

Overview

Cat #: STH-105
Alternative Name HWTX-XVI
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4437 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 1-10 µM
Sequence CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK
Modifications Disulfide bonds between Cys1-Cys16, Cys8-Cys21 and Cys15-Cys36.
Structure
Molecular formula C196H292N50O56S6
CAS No.: 1600543-88-1
Activity Huwentoxin-XVI is a potent and reversible N-type Ca2+ channel blocker1.
References-Activity
  1. Deng, M. et al. (2014) Neuropharmacology 79, 657.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in water. Centrifuge all products before use (10000 x g 5 min).
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
Our bioassay
  • Alomone Labs Huwentoxin-XVI inhibits the current of CaV2.2 channels expressed in Xenopus oocytes.
    Alomone Labs Huwentoxin-XVI inhibits the current of CaV2.2 channels expressed in Xenopus oocytes.
    A. Representative time course of Huwentoxin-XVI (#STH-105) inhibition of CaV2.2 (α1B + α2δ1 + β1) channel peak current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and inhibited by 7.5 µM Huwentoxin-XVI (green). B. Superimposed traces of CaV2.2 currents after application of control (black) and of 7.5 µM Huwentoxin-XVI (green), taken from the recording in A.
Scientific background

Huwentoxin XVI (HWTX-XVI) is a peptide toxin originally isolated from the Chinese bird spider Selenocosmia huwena venom1.

Huwentoxin-XVI is a specific blocker of N-type (CaV2.2) Ca2+ channels. It has no effect on voltage-gated T-type Ca2+ channels, K+ channels or Na+ channels.

Treatment with this toxin was shown to almost completely block the twitch response of rats in response to low-frequency electrical stimulation and to elicit significant analgesic responses to formalin-induced inflammation pain, In addition it has been shown to have higher reversibility rate than other known Ca2+ channels blockers. These findings suggest that HWTX-XVI could be a novel potential analgesic agent with high potency and low side effects2.

Target N-type Ca2+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-CACNA1B (CaV2.2) Antibody (#ACC-002)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. α-Conotoxin PeIA (#STC-970)
  2. ω-Conotoxin CnVIIA (#STC-800)
  3. ω-Conotoxin CVIA (#STC-750)
  4. ω-Conotoxin CVIF (#STC-770)
  5. ω-Conotoxin GVIA (#C-300)
  6. ω-Conotoxin MVIIA (#C-670)

Explorer kits & Research packs

Explorer kits
  1. CaV2 Channel Blocker Explorer Kit (#EK-110)

Resources

  • N-type Ca2+ channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • N-type Ca2+ channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order