Overview
Cat #:
STJ-500
Alternative Name Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51
Lyophilized Powder yes
Origin Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Source Synthetic peptide
MW: 4150.7 Da
Purity: >98% (HPLC)
Form Lyophilized Powder
Effective concentration 50 nM - 0.5 µM
Sequence ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV-OH
Modifications Disulfide bonds location - Cys2-16, Cys9-21 and Cys15-29
Molecular formula C182H258N52O49S6
Activity JzTx-34 activates hNav1.1, hNav1.3 and hNav1.6. The peptide also blocks hNav1.2, Nav1.5, Nav1.7 and hERG channels, and mildly inhibits hNav1.41. JZTX-34 shows analgesic activity in rodent pain models. In addition, this toxin inhibits voltage-gated potassium channels (Kv) in rat DRG neurons2.
Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, it should be stored at -20°C. Protect from moisture.
Solubility Soluble in water. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in ddH2O at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer. The preparation of fresh solutions in working buffers before use is recommended. Centrifuge all product preparations before use (10000 x g, 5 min). Repeat freeze-thawing might result in a loss of activity.
Storage of solutions The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thaw cycles.
Scientific background Jingzhaotoxin-34 (JZTX-34) is a 35 amino acid peptidyl toxin, originally isolated from the venom of the Chinese earth tiger tarantula, Chilobrachys guangxiensis1,2.
JzTx-34 was reported first as a potent and selective blocker of the voltage-gated sodium (NaV) 1.7 channel and a weak blocker of the Nav1.3 channel3. Recently, it has been found that JzTx-34 has more potent activity as an activator of hNav1.14. In addition, at higher concentrations than hNav1.1, this toxin activated hNav1.3 and hNav1.6 channels and also blocked hNav1.2, hNav1.4, hNav1.5, hNav1.7, and hERG channels4. Moreover, JzTx-34 inhibited voltage-gated potassium (Kv) channels in rat DRG neurons3.
Nav channels are transmembrane proteins that control the voltage-dependent increase in sodium permeability. They play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. NaV1.1 channel has been utilized as a therapeutic target for various brain disorders, including epilepsy, Alzheimer's disease, and autism. The NaV1.1 channel also contributes to mechanical pain by regulating the excitability of a specific subset of sensory neurons within the peripheral nervous system. Several studies, including the analysis of mutations associated with an increase or absence of pain sensitivity in humans, have revealed that Nav1.7, Nav1.8, and Nav1.9 are the most important contributors that control nociceptive neuronal electrogenesis5. JZTX-34 exhibited analgesic activity in three rodent pain models3.
Target hNav1.1 activator, Nav1.7 blocker
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
