Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Activators

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Jingzhaotoxin-II

U7-theraphotoxin Cg1a, JZTX-2, Peptide F2-32.19

An Activator of NaV Channels

Back to product page SDS

Overview

Cat #: STJ-150
Alternative Name U7-theraphotoxin Cg1a, JZTX-2, Peptide F2-32.19
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3561 Da
Purity: >98% (HPLC)
Effective concentration 200-500 nM.
Sequence GCGTMWSPCSTEKPCCDNFSCQPAIKWCIWSP.
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, Cys15-Cys28.
Structure
Molecular formula C154H219N39O45S7.
Activity Jingzhaotoxin-II significantly slows rapid inactivation of TTX-resistant VGSC in cardiac myocytes and TTX-sensitive Na+ channels1.
References-Activity
  1. Wang, M. et al. (2008) Biochem. Pharmacol. 76, 1716.
Accession number B1P1B9.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs Jingzhaotoxin-II activates NaV1.5 currents in stably transfected HEK293 cells.
    Alomone Labs Jingzhaotoxin-II activates NaV1.5 currents in stably transfected HEK293 cells.
    A. Time course of Jingzhaotoxin-II (#STJ-150) action. Current area was plotted as a function of time. Holding potential was -100 mV and currents were stimulated every 20 seconds by a voltage step of 50 msec from holding potential to -20 mV. 500 nM Jingzhaotoxin-II was perfused in the period marked by the horizontal bar (green), indicating a toxin-dependent decrease in NaV1.5 currents inactivation. B. Superimposed traces of NaV1.5 currents before and during 7 min application of 500 nM Jingzhaotoxin-II.
Scientific background

Voltage-gated Na+ channels play a very important role in the upstroke of action potentials, forming the basis for electrical signaling in the nervous system, and control the flow of ions across plasma membrane in response to changes in voltage1. In vertebrates, nine different pore-forming Na+ channels α subunits have been characterized and cloned in cardiac myocytes, neurons, and skeletal muscle. These Na+ channel isoforms are often classified as TTX-sensitive (NaV1.1–1.4, NaV1.6, and NaV1.7) and TTX-resistant (NaV1.5, NaV1.8, and NaV1.9)2.

NaV1.5, the major cardiac voltage-gated Na+ channel, plays a central role in the generation of the cardiac action potential and in the propagation of electrical impulses in the heart3.

Jingzhaotoxin-II, a 32-residue polypeptide, isolated from the venom of Chinese tarantula Chilobrachys jingzhao. JZTX-II has a high affinity for the tetrodotoxin-resistant (TTX-R) voltage-gated Na+ channels in cardiac myocytes. It significantly slows rapid inactivation with an IC50 value of 260 nM. Although JZTX-II does not have an effect on TTX-R neuronal channels in DRG neurons it does affect TTX-sensitive Na+ currents by slowing down their inactivation4.

Target NaV Na+ Channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Anti-NaV1.5 (SCN5A) (493-511) Antibody (#ASC-005)
  2. Guinea pig Anti-NaV1.5 (SCN5A) Antibody (#ASC-005-GP (formerly AGP-008))
  3. Anti-NaV1.5 (SCN5A) (1978-2016) Antibody (#ASC-013)
  4. ATX-II (#STA-700)
  5. β-Pompilidotoxin (#P-180)
  6. α-Pompilidotoxin (#P-170)
  7. Anthopleurin-C (#A-400)

Resources

  • Setting the Pace with NaV1.5 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Setting the Pace with NaV1.5 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order