Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Voltage-Gated Na+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Jingzhaotoxin-III

Jingzhaotoxin-3, JZTX-III, β/κ-theraphotoxin-Cg1a, Beta/kappa-theraphotoxin-Cg1a, Beta/kappa-TRTX-Cg1a, Peptide F5-20.38, Jingzhaotoxin III

A Blocker of KV2.1 and NaV1.5 Channels

Back to product page SDS

Overview

Cat #: STJ-200
Alternative Name Jingzhaotoxin-3, JZTX-III, β/κ-theraphotoxin-Cg1a, Beta/kappa-theraphotoxin-Cg1a, Beta/kappa-TRTX-Cg1a, Peptide F5-20.38, Jingzhaotoxin III
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3919 Da
Purity: >98% (HPLC)
Effective concentration 200-500 nM.
Sequence DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP.
Modifications Disulfide bonds between Cys4-Cys19, Cys11-Cys24 and Cys18-Cys31.
Structure
Molecular formula C174H241N47O46S6.
CAS No.: 925463-91-8
Activity Inhibits NaV1.5 and KV2.1 channels1.
References-Activity
  1. Xiao, Y. et al. (2004) J. Biol. Chem. 279, 26220.
Accession number P62520.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs Jingzhaotoxin-III inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
    Alomone Labs Jingzhaotoxin-III inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
    A. Time course of Jingzhaotoxin-III (#STJ-200) action on KV2.1 currents. Current amplitude at +40 mV was plotted as a function of time. Membrane potential was held at -80 mV and oocyte were stimulated by a 100 ms voltage ramp to +40 mV. 200 nM Jingzhaotoxin-III (applied for 160 sec, green) was perfused during the period marked by the bar, as indicated and showed 80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 200 nM Jingzhaotoxin-III (taken from experiment in A).
Scientific background

Jingzhaotoxin-III (JZTX–III), a peptide toxin isolated from the venom of the Chinese tarantula Chilobrachys Jingzhao, is composed of 36 amino acid residues including 6 cysteines cross-linked in a pattern of I-IV, II-V, and III-VI1.

Electrophysiological recordings carried out in Xenopus laevis oocytes show that this toxin acts as a gating modifier of voltage-dependent K+ channels. It slows the rate of KV2.1 channel activation and increases the tail current deactivation, suggesting that toxin-bound channels can still open but are modified. JZTX- III selectively inhibits KV2.1 channels2. JZTX- III blocks KV2.1 currents with an IC50 value of 430 nM in Xenopus oocytes3. It has also been shown to block NaV1.5 with an IC50 value of 0.38 μM in rat cardiac myocytes1.

Target NaV1.5, KV2.1 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Jingzhaotoxin-XII (#STJ-100)
  2. ProTx-II (#STP-100)
  3. Anti-NaV1.5 (SCN5A) (1978-2016) Antibody (#ASC-013)
  4. Anti-NaV1.5 (SCN5A) (493-511) Antibody (#ASC-005)
  5. Guinea pig Anti-NaV1.5 (SCN5A) Antibody (#ASC-005-GP (formerly AGP-008))
  6. Guangxitoxin-1E (#STG-200)
  7. Shaker (KV)-Related Channel Antibody Explorer Kit (#AK-220)
  8. NaV Channel Activator Explorer Kit (#EK-203)
  9. TTX-Resistant NaV Channel Blocker Explorer Kit (#EK-106)
  10. Stromatoxin-1 (#STS-350)
  11. Shaker (KV)-Related Channel Blocker Explorer Kit (#EK-108)
  12. TTX-Resistant NaV Channel Antibody Explorer Kit (#AK-223)
  13. Anti-KV2.1 Antibody (#APC-012)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order