Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

KTX-Sp2

Potassium channel toxin alpha-KTX 12 Sp2

A Potent Blocker of KV1.3 and a weaker blocker of KV1.1 and KV1.2 

Back to product page SDS

Overview

Cat #: STK-050
Alternative Name Potassium channel toxin alpha-KTX 12 Sp2
Lyophilized Powder yes
Origin Scorpiops pococki (Scorpion)
Source Synthetic
MW: 3928.4 Da
Purity: >98% (HPLC)
Form Lyophilized Powder
Effective concentration 15 - 100 nM
Sequence SPLHGAKCSSSNQCTRPCRYGGGTHGKCMNGRCRCYG-OH
Modifications Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35
Molecular formula C155H244N58O49S7
Activity KTX-Sp2 is a potent blocker of Kv1.3 voltage-gated K+ channels and a weaker inhibitor of Kv1.1 and Kv1.2 channel1.
Accession number P0DQN5
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
Solubility Soluble in water.
Centrifuge all products before use (10000 x, g 5 min). Avoid multiple freezing and thawing.
Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C.
It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles. 
Scientific background

a-KTX 12 Sp2 (KTX-Sp2) is a 37 amino acid peptidyl toxin, which was originally screened and genetically engineered from the venom gland transcriptome database from the scorpion, Scorpiops Pocoki1. KTX-Sp2 effectively blocks the voltage-gated potassium (Kv) channel Kv1.3, and also weakly inhibits the Kv1.1 and Kv1.2 channels1. In a Jurkat T cell model system, KTX-Sp2 significantly reduced the levels of intracellular free calcium, inhibited cellular activation, and suppressed the release of the inflammatory cytokine interleukin (IL)-2, which exhibited a robust immunosuppressant effect1.

Kv channels play key roles in human physiology and pathology. The therapeutic targeting of KV1.3 with specific peptides and small molecule inhibitors shows great promise for treating various cancers and autoimmune diseases, such as multiple sclerosis, type I diabetes mellitus, psoriasis, contact dermatitis, rheumatoid arthritis, and myasthenia gravis2,3,4. In addition, the Kv1.3 channel in T lymphocytes is a validated therapeutic target for diverse autoimmune diseases5 and Ktx-Sp2 robustly inhibits the autoimmune response1.

Target Kv1.3, Kv1.2, Kv1.1
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021)
  2. Anti-KCNMA1 (KCa1.1) (1184-1200) Antibody (#APC-107)
  3. Anti-KV1.2 (KCNA2) (extracellular) Antibody (#APC-162)
  4. Anti-KV1.2 (KCNA2) Antibody (#APC-010)
  5. Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101)
  6. Anti-KV1.3 (KCNA3) (extracellular)-Biotin Antibody (#APC-101-B)
  7. Anti-KV1.3 (KCNA3) (extracellular)-FITC Antibody (#APC-101-F)
  8. Anti-KV1.3 (KCNA3) (extracellular)-PE Antibody (#APC-101-PE)
  9. Anti-KV1.3 (KCNA3) Antibody (#APC-002)
  10. Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101-GP (formerly AGP-005))

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Aa1 Toxin (#RTA-400)
  2. ADWX-1 (#STW-100)
  3. Agitoxin-1 (#STA-150)
  4. Agitoxin-2 (#STA-420)
  5. Agitoxin-2-Cys-TAMRA (#RTA-420-T)
  6. Charybdotoxin (#STC-325)
  7. Hemitoxin (#STH-500)
  8. Hongotoxin-1 (#STH-400)
  9. HsTx1 Toxin (#STH-300)
  10. Margatoxin (#STM-325)
  11. MCD peptide (#STM-250)
  12. OsK-1 Toxin (#STO-150)
  13. ShK (Stichodactyla Toxin) (#STS-400)
  14. Spinoxin (#STS-500)
  15. Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR)
  16. Urotoxin (#STU-200)
Blockers/Antagonists: small molecules
  1. CP 339818 hydrochloride (#C-115)
  2. UK-78282 hydrochloride (#U-100)

Explorer kits & Research packs

Explorer kits
  1. Shaker (KV1) Channel Blocker Explorer Kit (#EK-107)
Research packs
  1. KV1.3 (KCNA3) Channel Basic Research Pack (#ESB-501)
  2. KV1.3 (KCNA3) Channel Deluxe Research Pack (#ESD-501)
  3. KV1.3 (KCNA3) Channel Premium Research Pack (#ESP-501)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order