Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ca2+ Channels › Voltage-Gated Ca2+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Kurtoxin

A Selective and Potent Blocker of CaV3.1 and CaV3.2 Channels

Back to product page SDS

Overview

Cat #: STK-800
Lyophilized Powder yes
Origin

Synthetic peptide

MW: 7387 Da
Purity: >98% (HPLC)
Form Lyophilized powder
Effective concentration 10-200 nM
Sequence KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWGWTLSCYCQGLPDNARIKRSGRCRA
Modifications Cys12-Cys61, Cys16-Cys37, Cys23-Cys44, and Cys27-Cys46
Structure
Molecular formula C324H478N94O90S8
Activity Kurtoxin is a CaV3.1 and CaV3.2 channel blocker1,2.
References-Activity
  1. Chuang, R.S. et al. (1998) Nat. Neurosci. 1, 668.
  2. Lee, C.W. et al. (2011) Biochem. Biophys. Res. Commun. 416, 277.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in water. Centrifuge all products before use (10000 x g 5 min).
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
Our bioassay
  • Alomone Labs Kurtoxin blocks CaV3.1 channels expressed in Xenopus oocytes.
    Alomone Labs Kurtoxin blocks CaV3.1 channels expressed in Xenopus oocytes.
    A. Representative time course of Kurtoxin (#STK-800) inhibition of CaV3.1 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to -30 mV every 10 sec, and significantly inhibited by application of 50 nM Kurtoxin (green). B. Superimposed traces of CaV3.1 current following the application of control (black) and of 50 nM Kurtoxin (green), taken from the recording in A.
Scientific background

Kurtoxin is a peptide toxin originally isolated from the South African scorpion (Parabuthus transvaalicus) venom, and was the first characterized ligand for low voltage-gated calcium channels1,2. Kurtoxin potently blocks CaV3.1 and CaV3.2 channels displaying effective working concentrations as low as 50 nM.

Although Kurtoxin is very similar to other scorpion isolated toxins (also known as α-toxins) that target sodium channels, detailed NMR analyses uncovered a unique configuration that distinguishes it from α-toxins and, therefore, is believed to be essential for Kurtoxin’s binding ability3.

CaV3.1 and CaV3.2 are members of the T-type calcium channels that regulate calcium intake near resting membrane potential1. Members of the CaV3 ion channels control cardiac pacemaking, but may also play a role outside the nervous system as predicted by their overall distribution in the body1.

Target CaV3.1, CaV3.2 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-CACNA1G (CaV3.1) Antibody (#ACC-021)
  2. Anti-CACNA1G (CaV3.1)-ATTO Fluor-594 Antibody (#ACC-021-AR)
  3. Anti-CaV3.2 (CACNA1H) Antibody (#ACC-025)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. ProTx-I (#STP-400)
  2. ProTx-II (#STP-100)
  3. ProTx-II-Biotin (#STP-100-B)
Blockers/Antagonists: small molecules
  1. Mibefradil dihydrochloride hydrate (#M-150)
  2. ML 218 (#M-165)
  3. ML 218 hydrochloride (#M-166)
  4. NNC 55-0396 dihydrochloride (#N-205)
  5. NNC 55-0396 dihydrochloride hydrate (#N-206)
  6. SKF 96365 hydrochloride (#S-175)
  7. TTA-A2 (#T-140)
  8. TTA-P2 (#T-155)
  9. TTA-P2 (S-enantiomer) (#T-210)

Explorer kits & Research packs

Explorer kits
  1. T-Type CaV Channel Blocker Explorer Kit (#EK-111)
  2. CaV Channel Blockers for Pain Research Explorer Kit (#EK-385)
  3. CaV Channel Antibodies for Pain Research Explorer Kit (#AK-360)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order