Cat #: BLP-PC009
Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only, not for human use
Properties
Sequence
- GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1 (Accession P16388).
Accession (Uniprot) Number P16388
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-KV1.1 (KCNA1) Antibody (#APC-009), (1:200).
2. Anti-KV1.1 (KCNA1) Antibody, preincubated with Kv1.1/KCNA1 Blocking Peptide (#BLP-PC009).- Rat brain sections.
Mouse sciatic nerve (1:200) (Zhou, L. et al. (1998) J. Neurosci. 18, 7200.).
Last update: 02/01/2024