Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Antibodies to CaV Channels

Certificate of Analysis

L-Type CaV Channel Antibody Explorer Kit

A Screening Package of L-Type CaV Channel Antibodies Economically Priced

Back to product page
Cat #: AK-215
Size: 42 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CaV1.1 (CACNA1S) (extracellular) Antibody Cat #: ACC-314

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Immunogen
Peptide CGNVDPDESARIS, corresponding to amino acid residues 1219-1231 of rat CaV1.1 (Accession Q02485). 2nd extracellular loop, domain IV.
Homology
Mouse, human - identical.

Cav1.1/CACNA1S (extracellular) Blocking Peptide Cat #: BLP-CC314

Size: 40 µg

Anti-CaV1.2 (CACNA1C) Antibody Cat #: ACC-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Homology
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Cav1.2/CACNA1C Blocking Peptide Cat #: BLP-CC003

Size: 40 µg

Guinea pig Anti-CaV1.2 (CACNA1C) Antibody Cat #: ACC-003-GP (formerly AGP-001)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Homology
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Cav1.2/CACNA1C Blocking Peptide Cat #: BLP-CC003

Size: 40 µg

Anti-Human CaV1.2 (CACNA1C) Antibody Cat #: ACC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Immunogen
Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human CaV1.2 (exon 1B) (Accession Q13936). Intracellular, N-terminus.
Homology
Mouse, rat - 14/15 amino acid residues identical.

Human Cav1.2/CACNA1C Blocking Peptide Cat #: BLP-CC022

Size: 40 µg

Anti-CaV1.2a (CACNA1C) Antibody Cat #: ACC-013

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
Homology
Rat, guinea pig - 31/46 amino acid residues identical.

Cav1.2a/CACNA1C Blocking Peptide Cat #: BLP-CC013

Size: 0.15 mg

Anti-CaV1.3 (CACNA1D) Antibody Cat #: ACC-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3 (Accession P27732). Intracellular loop between domains II and III.
Homology
Hamster, mouse - 16/17 amino acid residues identical; human -15/17 amino acid residues identical; chicken - 12/17 amino acid residues identical.

Cav1.3/CACNA1D Blocking Peptide Cat #: BLP-CC005

Size: 40 µg

Anti-CaV1.3 (CACNA1D) (extracellular) Antibody Cat #: ACC-311

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)EQLTKETEGGNHS, corresponding to amino acid residues 215-227 of rat CaV1.3 (Accession P27732). 2nd extracellular loop, repeat I.
Homology
Mouse, human - identical.

Cav1.3/CACNA1D (extracellular) Blocking Peptide Cat #: BLP-CC311

Size: 40 µg

Anti-CaVpan α1 Antibody Cat #: ACC-004

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)DNFDYLTRDWSILGPHHLD, corresponding to amino acid residues 1506-1524 of rat CaV1.2 (Accession P22002). Intracellular, C-terminus region.
Homology
CaV1 family (α1C, α1D, α1F, α1S) from all known species - identical; CaV2 family (α1A, α1B, α1E) from all known species - 17/19 amino acid residues identical.

Pan CaV α 1 Blocking Peptide Cat #: BLP-CC004

Size: 40 µg

Anti-CACNA2D1 (CaVα2δ1) (extracellular) Antibody Cat #: ACC-015

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: H, R
Immunogen
Peptide EPFPSAVTIKSWVDK(C), corresponding to amino acid residues 27-41 of rabbit CaVα2δ1 precursor (Accession P13806). Extracellular, N-terminus.
Homology
Pig, human - identical; mouse, rat - 14/15 amino acid residues identical.

CACNA2D1/Cavα2δ1 (extracellular) Blocking Peptide Cat #: BLP-CC015

Size: 40 µg

Anti-CACNA2D2 (CaVα2δ2) (extracellular) Antibody Cat #: ACC-102

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IFC, IH, LCI, WB Reactivity: H, M, R
Immunogen
(C)DLEAWAEKFKVLASNR, corresponding to amino acid residues 850-865 of rat CaVα2δ2 (Accession Q8CFG6). Extracellular, N-terminus.
Homology
Mouse, human - identical.

CACNA2D2/Cavα2δ2 (extracellular) Blocking Peptide Cat #: BLP-CC102

Size: 40 µg

Anti-CACNA2D3 (CaVα2δ3) (extracellular) Antibody Cat #: ACC-103

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: H, M, R
Immunogen
Peptide CSWWHSDMTAKAQK, corresponding to amino acid residues 942-955 of rat CaVα2δ3 (Accession Q8CFG5). Extracellular.
Homology
Mouse, human - identical.

CACNA2D3/Cavα2δ3 (extracellular) Blocking Peptide Cat #: BLP-CC103

Size: 40 µg

Anti-CACNA2D4 (CaVα2δ4) (extracellular) Antibody Cat #: ACC-104

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)SERPQEMGRLLGEADG, corresponding to amino acid residues 881-896 of mouse CaVα2δ4 (Accession Q5RJF7). Extracellular.
Homology
Rat - 15/16 amino acid residues identical.
Human - not recommended for use with human samples.

CACNA2D4/Cavα2δ4 (extracellular) Blocking Peptide Cat #: BLP-CC104

Size: 40 µg

Anti-CACNB1 Antibody Cat #: ACC-106

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)DRATGEHASVHEYPGE, corresponding to amino acid residues 456-471 of rat CACNB1 (Accession P54283). Intracellular, adjacent to the C-terminus.
Homology
Mouse – identical; human - 14/16.

CACNB1 Blocking Peptide Cat #: BLP-CC106

Size: 40 µg

Anti-CACNB2 Antibody Cat #: ACC-105

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: M, R
Immunogen
Peptide (C)HEHVDRYVPHREHNHRE, corresponding to amino acid residues 571-587 of rat CACNB2 (Accession Q8VGC3). Intracellular, C-terminus.
Homology
Mouse - identical; human - 11/17 amino acid residues identical.

CACNB2 Blocking Peptide Cat #: BLP-CC105

Size: 40 µg

Anti-CACNB3 Antibody Cat #: ACC-008

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)DRNWQRNRPWPKDSY, corresponding to amino acid residues 463-477 of rabbit CACNB3 (Accession P54286). Intracellular, C-terminus.
Homology
Rat, mouse, human, Xenopus - identical; bovine - 14/15 amino acid residues identical.

CACNB3 Blocking Peptide Cat #: BLP-CC008

Size: 40 µg

Anti-CACNG1 (extracellular) Antibody Cat #: ACC-111

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: M, R
Immunogen
Peptide (C)DHWAVLSPHLEHHNE, corresponding to amino acid residues 30-44 of rat CACNG1 (Accession P97707). 1st extracellular loop.
Homology
Mouse - identical; human - 13/14 amino acid residues identical.

CACNG1 (extracellular) Blocking Peptide Cat #: BLP-CC111

Size: 40 µg

Anti-Stargazin Antibody Cat #: ACC-012

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Immunogen
Peptide (C)RATDYLQASAITRIPS, corresponding to amino acid residues 213-228 of mouse CaVγ2 (Accession O88602). Intracellular, C-terminus.
Homology
Rat, human - identical.

Stargazin Blocking Peptide Cat #: BLP-CC012

Size: 40 µg

Anti-CACNG3 Antibody Cat #: ACC-113

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)RSHSELLKKSTFAR, corresponding to amino acid residues 210-223 of rat CACNG3 (Accession Q8VHX0). Intracellular, C-terminus.
Homology
Mouse - identical, human - 12/14 amino acid residues identical.

CACNG3 Blocking Peptide Cat #: BLP-CC113

Size: 40 µg

Anti-CACNG4 Antibody Cat #: ACC-114

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, WB Reactivity: H, M, R
Immunogen
Peptide (C)EKNKELRFKTKRE, corresponding to amino acid residues 208-220 of rat CACNG4 (Accession Q8VHW9). Intracellular, C-terminus.
Homology
Mouse, human - identical.

CACNG4 Blocking Peptide Cat #: BLP-CC114

Size: 40 µg

Anti-CACNG5 (extracellular) Antibody Cat #: ACC-115

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)SESTVNVLKMIRS, corresponding to amino acid residues 87-99 of rat CACNG5 (Accession Q8VHW8). 1st extracellular loop.
Homology
Mouse, human - identical.

CACNG5 (extracellular) Blocking Peptide Cat #: BLP-CC115

Size: 40 µg

Anti-CACNG6 (extracellular) Antibody Cat #: ACC-112

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide CIKRLWQADVPAGR, corresponding to amino acid residues 87-100 of rat CACNG6 (Accession Q8VHW3).
Homology
Mouse – identical; human – 11/14 amino acid residues identical.

CACNG6 (extracellular) Blocking Peptide Cat #: BLP-CC112

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use

Related Products

  1. (S)(-)-Bay K8644 (#B-351)
  2. FPL 64176 (#F-160)
  3. Calcicludine (#SPC-650)
  4. CaV1.2 (CACNA1C) Channel Overexpressing Membrane Fraction (#LX-104)
  5. Non-L-Type CaV Channel Antibody Explorer Kit (#AK-216)
  6. L-Type CaV Channel Blocker Explorer Kit (#EK-103)
  7. CaV1.2 (CACNA1C) Channel Basic Research Pack (#ESB-100)
  8. CaV1.2 (CACNA1C) Channel Premium Research Pack (#ESP-100)
  9. CaV1.2 (CACNA1C) Channel Deluxe Research Pack (#ESD-100)

Resources

  • L-Type (CaV1) Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • L-Type (CaV1) Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top