Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › ASIC/ENaC/Degenerin Family › Acid-Sensing Ion Channels (ASIC) › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Mambalgin-2

Ma-2, Mamb-2, Pi-Dp2

A Selective and Reversible ASIC1a Channel Blocker

Back to product page SDS

Overview

Cat #: STM-400
Alternative Name Ma-2, Mamb-2, Pi-Dp2
Lyophilized Powder yes
Origin

Synthetic peptide

MW: 6538 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 20 – 300 nM.
Sequence LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK.
Modifications Disulfide bonds between Cys3-Cys19, Cys41-Cys49 and Cys50-Cys55.
Structure
Molecular formula C272H429N85O83S10.
Activity Mambalgin-2 is a blocker of ASIC1 channels1.
References-Activity
  1. Salinas, M. et al. (2014) J. Biol. Chem. 289, 13363.
Accession number P0DKS3.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs Mambalgin-2 inhibits ASIC1a channels expressed in Xenopus oocytes.
    Alomone Labs Mambalgin-2 inhibits ASIC1a channels expressed in Xenopus oocytes.
    A. Representative time course of Mambalgin-2 (#STM-400) inhibition of ASIC1a currents. Membrane potential was held at -80 mV, current was elicited every 50 sec by transient application of pH 5.5, and partially inhibited by 200 nM Mambalgin-2 (top bar). B. Superimposed traces of ASIC1a currents upon application of control and of 200 nM Mambalgin-2 (taken from the recording in A).
Scientific background

Mambalgin-2 is a peptide toxin originally isolated from Dendroaspis polylepis (Black mamba) venom. It is a selective and potent ASIC1a blocker2. Mambalgins belong to the three-finger toxin family, albeit their limited structural similarity3. Molecular docking of mambalgin-2 is predicted to interact with the acidic binding pocket of ASIC1a2. Further mutagenesis studies in chimeric proteins uncovered the interactions of mambalgin-2 with β-ball and Palm regions of ASIC1a that are associated with a pH sensing property2.

Acid-sensing ion channels (ASICs) are proton-gated sodium channels1. They are abundant in the central as well as in the peripheral nervous systems and are sensitive to environmental pH1.

Environmental pH can change dramatically due to certain circumstances such as inflammatory condition as evident during epileptic seizures or tumor outgrowth3. In such cases, ASICs transform into their open conformation and import sodium ions, which then elicit neuronal action potential3.

Target ASIC1 Channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-ASIC1 Antibody (#ASC-014)
  2. Guinea pig Anti-ASIC1 Antibody (#ASC-014-GP (formerly AGP-053))

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Mambalgin-1 (#STM-100)
  2. Mambalgin-3 (#STM-500)
  3. Hm3a Toxin (#STH-250)
  4. Psalmotoxin-1 (#STP-200)
Activators/Agonists: proteins
  1. MitTx Toxin (#M-100)

Explorer kits & Research packs

Explorer kits
  1. ASIC Channel Modulator Explorer Kit (#EK-113)
Research packs
  1. ASIC1 Channel Basic Research Pack (#ESB-200)
  2. ASIC1 Channel Premium Research Pack (#ESP-200)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order