Overview
Cat #:
STM-325
Alternative Name Potassium channel toxin α-KTx 2.2, MgTX-theraphotoxin-Hh2a, MgTX
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4179 Da
Purity: >98% (HPLC)
Effective concentration 50 pM - 50 nM.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH.
Modifications Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36.
Molecular formula C178H286N52O50S7.
CAS No.: 145808-47-5
Activity Margatoxin is a blocker of KV1.3 and KV1.6 channels.
Accession number P40755.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Margatoxin inhibits KV1.3 currents expressed in Xenopus oocytes.A. Time course of Margatoxin (#STM-325) action on Kv1.3 currents. Current amplitudes were plotted as a function of time. Membrane potential was held at –100 mV and oocytes were stimulated by a 100 ms voltage ramp to +60 mV. 0.5 nM Margatoxin were perfused as indicated by the bar (green) at + 55 mV for 180 sec. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 0.5 nM Margatoxin (taken from the experiment in A).
References - Scientific background
- Leonard, R.J. et al. (1992) Proc. Natl. Acad. Sci. U.S.A. 89, 10094.
- Garcia-Calvo, M. et al. (1993) J. Biol. Chem. 268, 18866.
Scientific background Margatoxin is a peptidyl toxin originally isolated from the scorpion Centruroides margaritatus. It is a specific blocker of KV1.3 channels (IC50~30 pM), but it also blocks KV1.6 and a splice variant of the Drosophila Shaker channels with IC50 of 5 and 150 nM respectively.2 In Xenopus oocytes the toxin is less potent and inhibits expressed KV1.3 channels with an apparent IC50 of ~1 nM.2
Target KV1.3, KV1.6 K+ channels
Peptide Content: 100%
Lyophilized Powder
Margatoxin (#STM-325) is a highly pure, synthetic, and biologically active peptide toxin.
Image & Title 
Alomone Labs Margatoxin blocks KV1.3 channel currents in Jurkat cells and human peripheral blood T cells.Current traces were elicited by 300 ms depolarizing pulses from a holding potential of -80 mV, with 10 mV steps. A. In Jurkat cells. B. In human peripheral blood T cells (PBTC). C. application of 10 nM Margatoxin (#STM-325) nearly completely abolishes currents, confirming that KV1.3 currents are the predominant component of the outward current in Jurkats cells and PTBCs.Adapted from Zhao, N. et al. (2013) PLoS ONE 8, e64629. with permission of PLoS.

Alomone Labs Margatoxin blocks KV1.3 channel currents in Jurkat cells and human peripheral blood T cells.Current traces were elicited by 300 ms depolarizing pulses from a holding potential of -80 mV, with 10 mV steps. A. In Jurkat cells. B. In human peripheral blood T cells (PBTC). C. application of 10 nM Margatoxin (#STM-325) nearly completely abolishes currents, confirming that KV1.3 currents are the predominant component of the outward current in Jurkats cells and PTBCs.Adapted from Zhao, N. et al. (2013) PLoS ONE 8, e64629. with permission of PLoS.
For research purposes only, not for human use
Last Update: 02/01/2024
Applications
Citations
Citations
Product citations
- Meneses, D. et al. (2016) Neural Plast. 2016, 8782518.
- Fellerhoff-Losch, B. et al. (2015) J. Neural Transm. 123, 137.
- Murray, J.K. et al. (2015) J. Med. Chem. 58, 6784.
- Arnoux, I. et al. (2013) Glia 61, 1582.
- Hu, L. et al. (2013) PLoS ONE 8, e54267.
- Vallejo-Gracia, A. et al. (2013) J. Leukoc. Biol. 94, 779.
- Yang, L. et al. (2013) Toxicol. Lett. 223, 16.
- Zhao, N. et al. (2013) PLoS ONE 8, e64629.
- Guan, D. et al. (2011) J. Neurophysiol. 106, 1722.
- Martel, P. et al. (2011) PLoS ONE 6, e20402.
- Menteyne, A. et al. (2009) PloS ONE 4, e6770.
