Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Ca2+-Activated K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Maurotoxin

K+ channel toxin α-KTx 6.2, MTX

A Potent Blocker of KCa and KV1 K+ Channels

Back to product page SDS

Overview

Cat #: STM-340
Alternative Name K+ channel toxin α-KTx 6.2, MTX
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3612 Da
Purity: >99% (HPLC)
Effective concentration 1-200 nM.
Sequence VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC.
Modifications Disulfide bonds between Cys3-Cys24, Cys9-Cys29, Cys13-Cys19 and Cys31-Cys34. Cys34 - C-terminal amidation.
Structure
Molecular formula C145H232N46O46S8.
Activity Maurotoxin activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa2.2, KCa3.1), KCNA (KCNA1, KCNA2 and KCNA3) and Shaker-B K+ currents and seems to be very potent blocker of either KCa3.1 and KCNA2 channels1.
References-Activity
  1. Kharrat, R. et al. (1997) FEBS. Lett. 406, 284.
Accession number P80719
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs Maurotoxin inhibits KV1.2 channels heterologously expressed in Xenopus oocytes.
    Alomone Labs Maurotoxin inhibits KV1.2 channels heterologously expressed in Xenopus oocytes.
    A. Superimposed example traces of KV1.2 channel currents in response to ramp depolarization (from -80 mV to 40 mV during 100 msec) before (black) and during the application of increasing concentrations of Maurotoxin (#STM-340) (inset) for 100 sec. B. Example of time course showing fast and reversible effect of 2 nM Maurotoxin on the current amplitude (as extracted from the ramp responses at 0 mV).
Scientific background

Maurotoxin (MTX) is a 34 amino acid long toxin, isolated from the venom of the scorpion Scorpio Maurus palmatus, and is classified as α-KTx6.2 scorpion toxin family, having four disulfide bridges1,2.

MTX activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa3.1), KV1 (KV1.1, KV1.2 and KV1.3) and Shaker-B K+ currents. MTX inhibits the binding of 125I-Apamin and 125I-Kaliotoxin to rat brain synaptosomal membranes with an IC50 of 5 nM and 30 pM, respectively3. Furthermore, MTX blocks KCNA1 (KV1.1), KCNA2 (KV1.2) and KCNA3 (KV1.3) expressed in Xenopus oocyes with an IC50 of 45 nM, 0.8 nM, and 180 nM, respectively3. Maurotoxin blocks Shaker-B K+ current with an IC50 of 2 nM4. In contrast to previous reports, MTX was recently shown to have no effect on KCa1.1, KCa2.1 and KCa2.2 small conductance KCa channels up to 300 nM in physiologically relevant ionic strength buffers, but rather produces a high and specific block towards KCa3.1 (IKca1, SK4) and KCNA2 (KV1.2) with IC50 of 1 nM and 0.1 nM, respectively5. Furthermore, MTX was shown to block Gardos channel in human red blood cells and to inhibit the KCa in activated human T-lymphocytes without affecting the voltage-gated K+ current encoded by KCNA35. Moreover, MTX inhibition was shown to be pH-dependent6,7.

In conclusion, Maurotoxin seems to be a very potent blocker of both KCa3.1 and KV1.2 channels.

Target KCa and KV1 K+ channels
Peptide Content: 100%
Lyophilized Powder
Image & Title Maurotoxin
Alomone Labs Maurotoxin causes membrane depolarization of mouse pancreatic duct cells through SK4 channel inhibition.Application of 10 nM Maurotoxin (#STM-340) to cells causes a significant depolarization of membrane potential by 4.7 ± 0.8 mV (n = 10).Adapted from Hayashi, M. et al. (2012) Am. J. Physiol. 303, C151. with permission of The American Physiological Society.
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Anti-KV1.2 (KCNA2) Antibody (#APC-010)
  2. Mouse Anti-KCNN4 (KCa3.1, SK4) (extracellular) Antibody (#ALM-051)
  3. α-Dendrotoxin (#D-350)
  4. Hemitoxin (#STH-500)
  5. Mouse Anti-KCNN4 (KCa3.1, SK4) (extracellular)-Biotin Antibody (#ALM-051-B)

Resources

  • Ca2+-Dependent K+ (KCa) Channels: At the Crossroads of Cell Metabolism

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Ca2+-Dependent K+ (KCa) Channels: At the Crossroads of Cell Metabolism

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order