Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Mitochondrial Calcium Uniporter Complex › Antibodies

Certificate of Analysis

Mitochondrial Ion Channel Antibody Explorer Kit

A Screening Package of Mitochondrial Ion Channel Antibodies Economically Priced

Back to product page
Cat #: AK-535
Size: 31 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CLIC4 Antibody Cat #: ACL-024

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Immunogen
Peptide (C)NGLKEEDKEPLIE, corresponding to amino acid residues 8-20 of human CLIC4 (Accession Q9Y696). Intracellular, N-terminus.
Homology
Rat, mouse - identical.

CLIC4 Blocking Peptide Cat #: BLP-CL024

Size: 40 µg

Anti-KCNK9 (TASK-3) (extracellular) Antibody Cat #: APC-044

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, R
Immunogen
Peptide (C)DDYQQLELVILQSEPHR, corresponding to amino acid residues 57-73 of rat KCNK9 (accession number Q9ES08). Extracellular, near the P1 loop.
Homology
Human - 15/17 amino acid residues identical.

KCNK9/TASK-3 (extracellular) Blocking Peptide Cat #: BLP-PC044

Size: 40 µg

Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody Cat #: APC-021

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: M, R
Immunogen
GST fusion protein with the sequence
SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC, corresponding to residues 1097-1196 of mouse KCNMA1 variant 2 (Accession Q08460-2). Intracellular, C-terminus.
Homology
Chicken - 91/99 amino acid residues identical; rabbit - 88/99 amino acid residues identical; turtle - 87/99 amino acid residues identical.

KCNMA1/KCa1.1 (1097-1196) Blocking Peptide Cat #: BLP-PC021

Size: 0.12 mg

Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody Cat #: APC-021-GP (formerly AGP-014)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC, corresponding to residues 1097-1196 of mouse KCNMA1 variant 2 (Accession Q08460-2). Intracellular, C-terminus.
Homology
Mouse – 21/21 amino acid residues identical to the canonical sequence (Accession Q08460); rat - 20/21 amino acid residues identical to the canonical sequence (Accession Q62976); human - 19/21 amino acid residues identical to the canonical sequence (Accession Q12791).

KCNMA1/KCa1.1 (1097-1196) Blocking Peptide Cat #: BLP-PC021

Size: 0.12 mg

Anti-KCNMA1 (KCa1.1) (1184-1200) Antibody Cat #: APC-107

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)STANRPNRPKSRESRDK, corresponding to amino acid residues 1184-1200 of mouse KCNMA1 (Accession number Q08460). Intracellular, C-terminal part.
Homology
Rat - identical; human, bovine, chicken, dog - 16/17 amino acid residues identical.

KCNMA1/KCa1.1 (1184-1200) Blocking Peptide Cat #: BLP-PC107

Size: 40 µg

Anti-KCNMA1 (KCa1.1) (extracellular) Antibody Cat #: APC-151

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IFC, IH, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)DSSNPIES(S)QNFYKD, corresponding to amino acid residues 199-213 of rat KCNMA1 (Accession Q62976). 1st extracellular loop.
Homology
Rat, mouse, human - 14/15 amino acid residues identical.

KCNMA1/KCa1.1 (extracellular) Blocking Peptide Cat #: BLP-PC151

Size: 40 µg

Anti-KCNN4 (KCa3.1, SK4) Antibody Cat #: APC-064

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide RQVRLKHRKLREQV(C), corresponding to amino acid residues 350-363 of rat KCNN4 (Accession Q9QYW1). Intracellular, C-terminal part.
Homology
Mouse, human, pig - identical.

KCNN4/KCa3.1 Blocking Peptide Cat #: BLP-PC064

Size: 40 µg

Mouse Anti-KCNN4 (KCa3.1, SK4) (extracellular) Antibody Cat #: ALM-051

Size: 25 µg Host: Mouse Type: Monoclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Immunogen
Synthetic peptide mapping to the 3rd extracellular loop of human KCNN4 (Accession O15554).

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Homology
Rat, rabbit, mouse - identical.

Kv1.3/KCNA3 Blocking Peptide Cat #: BLP-PC002

Size: 0.12 mg

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Kv1.3/KCNA3 (extracellular) Blocking Peptide Cat #: BLP-PC101

Size: 40 µg

Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101-GP (formerly AGP-005)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). 1st extracellular loop.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Kv1.3/KCNA3 (extracellular) Blocking Peptide Cat #: BLP-PC101

Size: 40 µg

Anti-LETM1 Antibody Cat #: ANT-183

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)KELSKTGDEKYIEE, corresponding to amino acid residues 587-600 of rat LETM1 (Accession Q5XIN6). Intracellular, mitochondrial matrix.
Homology
Mouse –13/14 amino acid residues identical; human – 12/14 amino acid residues identical.

LETM1 Blocking Peptide Cat #: BLP-NT183

Size: 40 µg

Anti-MCUR1 (CCDC90A) Antibody Cat #: ACC-321

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)GRNALGRLRLGARR, corresponding to amino acid residues 97-110 of mouse mitochondrial calcium uniporter regulator 1 (Accession Q9CXD6). Intracellular loop, mitochondrial matrix.
Homology
Rat - identical; human – no apparent homology.

MCUR1/CCDC90A Blocking Peptide Cat #: BLP-CC321

Size: 40 µg

Anti-MICU1 Antibody Cat #: ACC-322

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)EFERHDPVDGRISER, corresponding to amino acid residues 313-327 of rat MICU1 (Accession Q6P6Q9). Intracellular.
Homology
Mouse - identical; human - 14/15 amino acid residues identical.

MICU1 Blocking Peptide Cat #: BLP-CC322

Size: 40 µg

Anti-MCU Antibody Cat #: ACC-328

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Immunogen
Peptide CIEQHQLNKERELIER, corresponding to amino acid residues 191-206 of human mitochondrial calcium uniporter (Accession Q8NE86). N-terminus, mitochondrial matrix.
Homology
Rat, mouse – 15/16 amino acid residues identical.

MCU Blocking Peptide Cat #: BLP-CC328

Size: 40 µg

Anti-VDAC Antibody Cat #: AVC-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)DGKNVNAGGHK, corresponding to amino acid residues of 264-274 of rat VDAC1 (Accession Q9Z2L0). Intracellular.
Homology
VDAC1: rat, mouse, human identical; VDAC2: rat, mouse, human - 9/11 amino acid residues identical; VDAC3: rat, mouse - 10/11 amino acid residues identical, human - 9/11 amino acid residues identical.

Pan VDAC Blocking Peptide Cat #: BLP-VC001

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A mouse monoclonal antibody (#ALM-051) and guinea pig polyclonal antibodies (#APC-101-GP & #APC-021-GP) are included in this Explorer Kit. Please take into account when reacting with a secondary antibody.
For research purposes only, not for human use

Resources

  • KV1.3 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • KV1.3 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top