Overview
Cat #:
M-100
Alternative Name MitTx, alpha/beta MitTx
Lyophilized Powder yes
Origin Natural protein isolated from Micrurus tener tener (Texas coral snake).
MW: 20.8 kDa (α subunit, 7.1 kDa and β subunit, 13.7 kDa)
Purity: >98% (HPLC)
Effective concentration 20 nM
Sequence MitTx-α subunit:
QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG.
MitTx-β subunit:
NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ.
QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG.
MitTx-β subunit:
NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ.
Modifications MitTx-α subunit contains pyrrolidone carboxylic acid at the N-terminus.
Activity MitTx toxin activates ASIC1-containing channels1,2.
References-Activity
- Bohlen, C.J. et al. (2011) Nature 479, 410.
- Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Water or any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs alpha/beta (1:1) MitTx Toxin activates ASIC1a channels expressed in Xenopus oocytes.Membrane potential was held at -80mV. ASIC1a channels current was elicited every 50 sec by transient pH 5.5 stimulation (arrows) or activated by a 3 min application of 50 nM MitTx Toxin (#M-100), as indicated.
Scientific background
alpha/beta MitTx (MitTx toxin) is a natural toxin isolated from the Texas Coral snake venom1. The purified active toxin consists of a heteromeric complex between Kunitz (α subunit) and phospholipase-A2-like (β subunit) proteins that together function as a potent, persistent and selective agonist for acid-sensing ion channels (ASICs), showing equal or greater efficacy compared with acidic pH1.
MitTx-α and MitTx-β form a high affinity 1:1 complex, and neither subunit demonstrates functional effects on its own1,2.
The purified ASIC-activating component of the venom, MitTx, was found to be sufficient to elicit robust nocifensive behaviors and is likely responsible for the lasting pain experienced by victims of coral snake envenomation2.
Target ASIC1 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 22/03/2024
Specifications
Citations
Citations
