Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ligand-Gated Ion Channels › GABA(A) Receptors › Agonists

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

MmTx1 Toxin-ATTO Fluor-488

Micrurotoxin 1

A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488

Back to product page SDS

Overview

Cat #: STM-550-AG
Alternative Name Micrurotoxin 1
Lyophilized Powder yes
Origin Synthetic peptide
MW: ~7775 Da
Purity: >99% (HPLC)
Form Lyophilized powder.
Effective concentration 200-400 nM.
Sequence LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCCTRDNCN.
Modifications Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63.
Label ATTO-488. Maximum absorption 501 nm; maximum fluorescence 523 nm. The fluorescence is excited most efficiently in the 480 – 515 nm range. This label is analogous to the well known dye fluorescein isothiocyanate (FITC) and can be used with filters typically used to detect FITC.
Structure
Molecular formula C295H455N95O97S10.
Activity MmTx1 is a potent allosteric modulator of GABA(A) receptors1.
References-Activity
  1. Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891.
Accession number C0HJR1.
Shipping and storage Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs MmTx1 Toxin-ATTO Fluor-488 labels GABA(A) α1 receptor in rat cerebellum.
    Alomone Labs MmTx1 Toxin-ATTO Fluor-488 labels GABA(A) α1 receptor in rat cerebellum.
    Rat brain sections were incubated with MmTx1 Toxin-ATTO Fluor-488 (#STM-550-AG) at a concentration of 25 nM. The sections were then incubated with Anti-GABA(A) α1 Receptor (extracellular) Antibody (#AGA-001), followed by donkey anti rabbit labeled with Cy3 (red). A. MmTx1 Toxin-ATTO Fluor-488 binding (green) appears in patches within the granule layer (GL), (arrows). B. GABA(A) α1 receptor immunostaining appears in profiles of GL neurons (arrow). C. Merge of the two images demonstrates variable colocalization. DAPI is used as the counterstain.
  • Alomone Labs MmTx1 Toxin ATTO-488 binds to rat cerebellum.
    Alomone Labs MmTx1 Toxin ATTO-488 binds to rat cerebellum.
    Rat cerebellum sections were incubated on ice for 2 hours with 30 nM MmTx1 Toxin-ATTO Fluor-488 (#STM-550-AG). Staining (green) was observed mainly in the granule layer (GL) and some labeling in the molecular layer (MOL). DAPI is used as the counterstain (blue). Images were acquired with a 40x objective of a confocal Zeiss LSM 710 microscope.
  • Alomone Labs MmTx1 Toxin-ATTO Fluor-488 modulates GABA(A) receptors expressed in Xenopus oocytes.
    Alomone Labs MmTx1 Toxin-ATTO Fluor-488 modulates GABA(A) receptors expressed in Xenopus oocytes.
    A. Representative time course of GABA(A) α1/β2 current activated at a holding potential of -60 mV by 50 nM Muscimol hydrobromide (#M-240) application (black bars), and modulated by co-application of 200 nM MmTx1 Toxin-ATTO Fluor-488 (#STM-550-AG), as indicated (green bar). A significant modulation of receptor desensitization and reactivation rate are observed. B. Superimposed traces of GABA(A) currents upon application of 50 nM Muscimol hydrobromide (black) or co-application of 50 nM Muscimol and 200 nM MmTx1Toxin-ATTO Fluor-488 (green). Taken from the recording in A.
  • Alomone Labs MmTx1 Toxin-ATTO Fluor-488 modulates GABA(A) receptors expressed in Xenopus oocytes.
    Alomone Labs MmTx1 Toxin-ATTO Fluor-488 modulates GABA(A) receptors expressed in Xenopus oocytes.
    A. Representative time course of GABA(A) α1/β2 current activated at a holding potential of -80 mV by 50 nM Muscimol hydrobromide (#M-240) application (black bars), and modulated by co-application of 400 nM MmTx1 Toxin-ATTO Fluor-488 (#STM-550-AG), as indicated (green bar). A significant modulation of receptor desensitization and reactivation rate are observed. B. Superimposed traces of GABA(A) currents upon application of 50 nM Muscimol hydrobromide (black) or co-application of 50 nM Muscimol and 400 nM MmTx1 Toxin-ATTO Fluor-488 (green). Taken from the recording in A.
Scientific background

MmTx1 (Micrurotoxin 1) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venom. The toxin is an allosteric modulator of γ-aminobutyric acid type A receptors (GABA(A)) and tightly binds to GABA(A) receptors at subnanomolar concentrations. MmTx1 allosterically increases GABA(A) receptor susceptibility to agonistic actions, thereby potentiating receptor opening and desensitization by interacting with the α+/β−interface, a benzodiazepine-like binding site1. MmTx1 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.

GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.

Target GABA(A) receptors
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-GABA(A) α1 Receptor (extracellular) Antibody (#AGA-001)
  2. Guinea pig Anti-GABA(A) α1 Receptor (extracellular) Antibody (#AGA-001-GP (formerly AGP-083))
  3. Anti-GABA(A) γ2 Receptor (extracellular) Antibody (#AGA-005)
  4. Anti-GABA(A) ε Receptor (GABRE) (extracellular) Antibody (#AGA-015)

Pharmacological tools

Blockers/Antagonists: small molecules
  1. (+)-Bicuculline (#B-135)
  2. (-)-Bicuculline methochloride (#B-137)
  3. GABA(A)-Compound 1b (#CMG-004)
  4. Gabazine hydrobromide (#G-216)
  5. Picrotoxin (#P-325)
Activators/Agonists: small molecules
  1. AA 29504 (#A-370)
  2. SJM-3 (#S-215)
Modulators: peptides/peptide toxins
  1. MmTx1 Toxin (#STM-550)
  2. MmTx2 Toxin (#STM-600)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order