Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ligand-Gated Ion Channels › Glutamate Receptors › NMDA Receptors › Explorer Kits

Certificate of Analysis

NMDA Receptor Interacting Protein Antibody Explorer Kit

A Screening Package of NMDA Receptor Interacting Protein Antibodies Economically Priced

Back to product page
Cat #: AK-615
Size: 22 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-AKAP150 Antibody Cat #: APZ-031

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)RGAKRSRPSKLTED, corresponding to amino acid residues 128-141 of rat AKAP5 (Accession P24587). Intracellular.
Homology
Mouse – 13/14 amino acid residues identical.

AKAP150 Blocking Peptide Cat #: BLP-PZ031

Size: 40 µg

Anti-Homer1 Antibody Cat #: APZ-026

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KQEIDNARELQEQR, corresponding to amino acid residues 293-296 of rat Homer1 (Accession Q9Z214). Intracellular.
Homology
Mouse, human – identical.

Homer1 Blocking Peptide Cat #: BLP-PZ026

Size: 40 µg

Anti-Kidins220 Antibody Cat #: APZ-017

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)PRHSNLSWQSQTRR, corresponding to amino acid residues 1335-1348 of rat Kidins220 (Accession Q9EQG6). Intracellular, C-terminus.
Homology
Mouse, human – identical.

Kidins220 Blocking Peptide Cat #: BLP-PZ017

Size: 40 µg

Anti-Pannexin 1 Antibody Cat #: ACC-234

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KEPTEPKFKGLRLE, corresponding to amino acid residues 18- 31 of human PANX1 (Accession Q96RD7). Intracellular, N-terminus.
Homology
Rat, mouse - identical.

Pannexin 1 Blocking Peptide Cat #: BLP-CC234

Size: 40 µg

Anti-PICK1 Antibody Cat #: APZ-014

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RARFSQMRKDVLEK, corresponding to amino acid residues 305-318 of rat PICK1 (Accession Q9EP80). Intracellular, α-helix domain.
Homology
Mouse, human - identical.

PICK1 Blocking Peptide Cat #: BLP-PZ014

Size: 40 µg

Anti-PSD-93 Antibody Cat #: APZ-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: M, R
Immunogen
GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110 (Accession Q63622). Between PDZ2 and PDZ3 domains.
Homology
Human - 42/44 amino acid residues identical.

PSD-93 Blocking Peptide Cat #: BLP-PZ002

Size: 0.12 mg

Anti-PSD-95 Antibody Cat #: APZ-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KDWGSSSGSQGRED, corresponding to amino acid residues 505-518 of human PSD-95 (Accession P78352). Intracellular, between the SH3 and the GK-like domains.
Homology
Rat, mouse – identical.

PSD-95 Blocking Peptide Cat #: BLP-PZ009

Size: 40 µg

Anti-SAP-97/DLG1 Antibody Cat #: APZ-010

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)EYRSKLSQTEDRQLR, corresponding to amino acid residues 17-31 of human SAP-97 (Accession Q12959). N-terminus, L27 domain.
Homology
Rat, mouse - identical.

SAP-97/DLG1 Blocking Peptide Cat #: BLP-PZ010

Size: 40 µg

Anti-Shank1 Antibody Cat #: APZ-011

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)RSQEGRQESRSDKAK, corresponding to amino acid residues 614-628 of rat Shank1 (Accession Q9WV48). Intracellular, between the SH3 and PDZ domains.
Homology
Mouse - identical; human - 13/15 amino acid residues identical.

Shank1 Blocking Peptide Cat #: BLP-PZ011

Size: 40 µg

Anti-Shank3 Antibody Cat #: APZ-013

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EKLPGSLRKGIPRTK, corresponding to amino acid residues 841-855 of rat Shank3 (Accession Q9JLU4). Intracellular, between the PDZ and the SAM domains.
Homology
Mouse, human - identical.

Shank3 Blocking Peptide Cat #: BLP-PZ013

Size: 40 µg

Anti-Sigma-1 Receptor Antibody Cat #: AIP-006

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)SRGHSGRYWAEISD, corresponding to amino acid residues 113-126 of human SIGMAR1 (Accession Q99720). Intracellular, C-terminus.
Homology
Rat, mouse – identical.

Sigma-1 Receptor Blocking Peptide Cat #: BLP-IP006

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use

Related Products

  1. 5,7-Dichlorokynurenic acid (#D-190)
  2. 7-Chlorokynurenic acid (#C-285)
  3. CGP-37849 (#C-325)
  4. CGS 19755 (#C-310)
  5. DL-AP5 (#D-140)
  6. D-AP5 (#D-145)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top