Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Research Areas › Cardiac Membrane Proteins › Cardiac Ion Channels › Antibodies

Certificate of Analysis

Pacemaker Cell Marker Antibody Kit

A Screening Package of Antibodies to SAN Expressing Proteins Economically Priced

Back to product page
Cat #: AK-620
Size: 22 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Guinea pig Anti-HCN1 Antibody Cat #: APC-056-GP (formerly AGP-203)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: R
Immunogen
Peptide (C)KPNSASNSRDDGNSVYPSK, corresponding to amino acid residues 6-24 of rat HCN1 (Accession Q9JKB0). Intracellular, N-terminus.
Homology
Mouse - 18/19 amino acid residues identical; human - 16/19 amino acid residues identical.

HCN1 Blocking Peptide Cat #: BLP-PC056

Size: 40 µg

Guinea pig Anti-HCN4 Antibody Cat #: APC-052-GP (formerly AGP-004)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HGHLHDSAEE RRLIAEGDASPGEDRTPPGLAAEPERP, corresponding to amino acid residues 119-155 of human HCN4 (Accession Q9Y3Q4). Intracellular, N-terminus.
Homology
Rabbit - identical; rat - 35/37 amino acid residues identical; mouse - 33/37 amino acid residues identical.

HCN4 Blocking Peptide Cat #: BLP-PC052

Size: 0.15 mg

Anti-Connexin-32 Antibody Cat #: ACC-211

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)EINKLLSEQDGSLK, corresponding to amino acid residues 247-260 of rat Connexin-32 (Accession P08033). Intracellular, C-terminus.
Homology
Human, mouse – identical.

Connexin-32 Blocking Peptide Cat #: BLP-CC211

Size: 40 µg

Anti-Connexin-45 (GJC1) Antibody Cat #: ACC-207

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KEQSQPKPKHDGRR, corresponding to amino acid residues 153-166 of rat Connexin-45 (Accession A4GG66). Intracellular loop.
Homology
Mouse, human - identical.

Connexin-45/GJC1 Blocking Peptide Cat #: BLP-CC207

Size: 40 µg

Guinea pig Anti-CaV1.3 (CACNA1D) Antibody Cat #: ACC-005-GP (formerly AGP-061)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3 (Accession P27732). Intracellular loop between domains II and III.
Homology
Mouse - 16/17 amino acid residues identical; human -15/17 amino acid residues identical.

Cav1.3/CACNA1D Blocking Peptide Cat #: BLP-CC005

Size: 40 µg

Anti-CACNA1G (CaV3.1) Antibody Cat #: ACC-021

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide MDEEEDGAGAEESGQPRSFTQL(C), corresponding to amino acid residues 1-22 of rat CACNA1G (Accession O54898). Intracellular, N-terminus.
Homology
Mouse - identical; human - 20/22 amino acid residues identical.

CACNA1G/Cav3.1 Blocking Peptide Cat #: BLP-CC021

Size: 40 µg

Anti-CaV3.2 (CACNA1H) Antibody Cat #: ACC-025

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide CHVEGPQERARVAHS, corresponding to amino acid residues 581-595 of rat CaV3.2 (Accession number Q9EQ60). Intracellular loop between domains D1 and D2.
Homology
Mouse, bovine and canis - 14/15 amino acid residues identical; human - 13/15 amino acid residues identical.

Cav3.2/CACNA1H Blocking Peptide Cat #: BLP-CC025

Size: 40 µg

Anti-Ryanodine Receptor 2 Antibody Cat #: ARR-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide CAGESMSPGQGRNN, corresponding to amino acid residues 1489-1502 of human RyR2 (Accession Q92736). Intracellular, N-terminus.
Homology
Rat, mouse - identical.

Ryanodine Receptor 2 Blocking Peptide Cat #: BLP-RR002

Size: 40 µg

Anti-KCNQ1 Antibody Cat #: APC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human KCNQ1 (Accession P51787). Intracellular, C-terminus.
Homology
Rat, mouse - 14/16 amino acid residues identical.

KCNQ1 Blocking Peptide Cat #: BLP-PC022

Size: 40 µg

Anti-KCNH2 (HERG) Antibody Cat #: APC-062

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Homology
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

KCNH2/HERG Blocking Peptide Cat #: BLP-PC062

Size: 0.12 mg

Anti-NCX1 (SLC8A1) Antibody Cat #: ANX-011

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EVDERDQDDEEAR, corresponding to amino acid residues 308-320 of rat NCX1 (Accession Q01728). 3rd intracellular loop.
Homology
Human, mouse - identical.

NCX1/SLC8A1 Blocking Peptide Cat #: BLP-NX011

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top