Overview
Cat #:
STP-710
Alternative Name κ-theraphotoxin-Ps1b, κ-TRTX-Ps1b, PaTX2, Kappa-theraphotoxin-Ps1b
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3922 Da
Purity: >99% (HPLC)
Effective concentration 100-500 nM
Sequence YCQKWMWTCDEERKCCEGLVCRLWCKRIINM-NH2
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25
Met31 - C-terminal methionine amide
Met31 - C-terminal methionine amide
Molecular formula C169H259N49O43S8
CAS No.: 221889-63-0
Activity Phrixotoxin-2 specifically and reversibly blocks KV4.21.
Accession number P61231
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10,000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Phrixotoxin-2 inhibits KV4.2 channel expressed in Xenopus oocytes.A. Time course of Phrixotoxin-2 (#STP-710) action on KV4.2 peak current amplitude. Peak current amplitudes were plotted as a function of time. Membrane potential was held at -90 mV and oocytes were stimulated by a 100 ms voltage step to 0 mV. 200 nM Phrixotoxin-2 was perfused as indicated by the bar (green) for 160 sec. B. Superimposed examples of KV4.2 channel maximum peak current in the absence (control) and presence (green) of 200 nM Phrixotoxin-2 (taken from the experiment in A).
References - Scientific background
- Diochot, S. et al. (1999) Br. J. Pharmacol. 126, 251.
Scientific background Phrixotoxin-2 is a natural peptide isolated from the Phrixotrichus auratus Tarantula venom. It blocks specifically and reversibly KV4.2 and KV4.3 channels.1 These channels are probably the molecular counterparts of the A-type current (Ito1) in the heart. Cloned KV4.2 and KV4.3 channels heterologously expressed in COS cell were blocked with IC50 of 34 and 71 nM of Phrixotoxin-2 respectively1.
Target KV4 channels
Peptide Content: 100%
Lyophilized Powder
Phrixotoxin-2 (#STP-710) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Last Update: 02/01/2024
Applications
Citations
Citations
Product citations
- Meneses, D. et al. (2016) Neural Plast. 2016, 8782518.
- Subramaniam, M. et al. (2014) J. Neurosci. 34, 13586.
