Overview
Cat #:
STP-720
Alternative Name PaurTx3, β-TRTX-Ps1a, β-theraphotoxin-Ps1a, Phrixotoxin 3
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4060 Da
Purity: >99% (HPLC)
Effective concentration 0.5-300 nM.
Sequence DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI.
Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30. Ile34 - C-terminal amidation.
Structure
Molecular formula C176H270N52O47S6.
Activity Phrixotoxin-3 specifically and reversibly blocks NaV1.21.
References-Activity
- Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.
Accession number P84510.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10,000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Phrixotoxin-3 blocks NaV1.2 channels expressed in Xenopus oocytes.A. Time course of Phrixotoxin-3 (#STP-720) action on NaV1.2 peak current amplitude. Peak current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage step to 0 mV. 250 nM Phrixotoxin-3 were perfused as indicated by the bar (green) for 160 sec. B. Superimposed examples of NaV1.2 channel maximum peak current in the absence (control) and presence (green) of 250 nM Phrixotoxin-3 (taken from the experiment in A).
Alomone Labs Phrixotoxin-3 blocks NaV1.6 channels expressed in Xenopus oocytes.A. NaV1.6 currents were elicited by a 100 ms voltage step from a holding potential of -100 mV to -10 mV every 10 sec. Phrixotoxin-3 (#STP-720), applied at 100 nM and 500 nM, as indicated (bars), inhibits Nav1.6 currents in a concentration dependent manner. B. Superimposed NaV1.6 current traces (taken from the experiment in A) upon application of control, or of 100 nM and 500 nM Phrixotoxin-3 (as indicated).
Scientific background
Phrixotoxin-3 is a peptidyl toxin originally isolated from the venom of Phrixotrichus auratus tarantula. This toxin is a highly specific and potent blocker of voltage-gated Na+ channels especially the neuronal channel NaV1.2 with properties similar to those of typical gating-modifier toxins. It causes a depolarizing shift in the gating kinetics by blocking the inward component of the sodium current1.
Injection of Phrixotoxin-3 to mice causes neurotoxicity symptoms that are expressed by general ataxia, lack of response to stimuli, and semiparalysis1.
Target NaV1.2, NaV1.6 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations
