Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Na+ Channels › Acid-Sensing Ion Channels (ASIC) › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Psalmotoxin-1

PcTx-1, PcTx1, π-Theraphotoxin-Pc1a, Psalmotoxin 1

A Potent Blocker of ASIC1a Channels

Back to product page SDS

Overview

Cat #: STP-200
Alternative Name PcTx-1, PcTx1, π-Theraphotoxin-Pc1a, Psalmotoxin 1
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4689.5 Da
Purity: >99% (HPLC)
Effective concentration 1-10 nM.
Sequence EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT.
Modifications Disulfide bonds between Cys3-Cys18, Cys10-Cys23 and Cys17-Cys33.
Structure
Molecular formula C200H312N62O57S6.
Activity Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2.
References-Activity
  1. Chen, X. et al. (2005) J. Gen. Physiol. 126, 71.
  2. Chen, X. et al. (2006) J. Gen. Physiol. 127, 267.
Accession number

P60514

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs Psalmotoxin-1 inhibits cation currents of ASIC1a expressed in Xenopus oocytes.
    Alomone Labs Psalmotoxin-1 inhibits cation currents of ASIC1a expressed in Xenopus oocytes.
    Membrane potential was held at 5 mV and whole cell currents were continuously recorded using TEVC. ASIC1a currents were elicited by rapid (~2 sec) exposure to pH 5 in physiological solution (indicated by arrows). During the time indicated by the horizontal bar, 5 nM, 10 nM and 20 nM Psalmotoxin-1 (#STP-200) were introduced into the bath via perfusion. 20 nM Psalmotoxin-1 resulted in a complete, yet fairly reversible inhibition of the pH dependent inward transients.
Scientific background

Native Psalmotoxin1 (PcTx1) is a 40-amino acid toxin originally isolated from the venom of the South American tarantula Psalmopoeus cambridgei.1

PcTX1 is characterized by the unusual quadruplet Lys25-Arg26-Arg27-Arg28, which probably forms a strongly positive "patch" at the surface of the toxin molecule, constituting an area that is a strong candidate for channel binding site recognition. The molecular scaffold of PcTX1 is likely to be similar to that previously described for both cone snail and spider toxins5,6 and comprises a triple-stranded antiparallel β-sheet structure reticulated by three disulfide bridges.1

PcTx1 potently (IC50 = 0.9 nM) and specifically blocks a particular subclass of H+-gated cation channels, the Acid-sensing ion channels 1a (ASIC1a) and is able to discriminate between the two splice variant subtypes and not block the ASIC1b channel (which differs only in its N-terminal sequence). Moreover, PcTX1 loses its capacity to block ASIC1a as soon as this subunit is associated with another member of the family (ASIC2a or ASIC3).1

The ASICs are abundant in the brain and spinal cord neurons and are implicated in pain sensation, ischemic stroke mechanosensation, learning and memory.2,3 In acute and neuropathic pain models, specific blockage of ASIC1a with PcTx1 results in analgesic effects working upstream of the opiate receptors.4

Using an iodinated form of the toxin, the binding for the PcTX1 site identifies at the cysteine-rich domains I and II (CRDI and CRDII) of the extracellular loop of ASIC1a. A disulphide bridge between domains 1 and 4 of the channel supports a close relationship between the CRDI4–CRDII domain, where PcTx1 acts, and the post-M1 region, the binding site for the proton.7

Target ASIC1a channels
Peptide Content: 100%
Lyophilized Powder
Image & Title

Psalmotoxin-1
Alomone Labs Psalmotoxin-1 inhibits ASIC1a in mouse MNTB neurons.IASICs in mouse neurons of the medial nucleus of the trapezoid body (MNTB) were activated by a drop in pH from 7.3 to 6.0. Application of 10 nM Psalmotoxin-1 (#STP-200) almost abolished IASICs suggesting that ASIC1a homomers make up the majority of IASICs in MNTBs.Adapted from Gonzalez-Inchauspe, C. et al. (2017) J. Neurosci. 37, 2589. with permission of the Society for Neuroscience.

For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Anti-ASIC1 Antibody (#ASC-014)
  2. Guinea pig Anti-ASIC1 Antibody (#ASC-014-GP (formerly AGP-053))
  3. Mambalgin-1 (#STM-100)
  4. Mambalgin-2 (#STM-400)

Resources

  • ENaC and ASIC Channels at a Glance

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • ENaC and ASIC Channels at a Glance

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order