Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Growth Factors and Receptors › Insulin Growth Factors and Receptors › Proteins

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Recombinant rat IGF-I protein

Insulin-like growth factor I, Somatomedin C, IGF-1, IGFIA, IGF1, IBP1

Rat Insulin-like growth factor I, Recombinant, E. coli

Back to product page SDS

Overview

Cat #: I-200
Alternative Name Insulin-like growth factor I, Somatomedin C, IGF-1, IGFIA, IGF1, IBP1
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 7692 Da
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Effective concentration The ED50 as determined by a cell proliferation assay using FDC-P1 cells is less than 2.0 ng/ml, corresponding to a specific activity of >500,000 units/mg.
rat IGF-I is fully biologically active when compared to standards. The ED50 shown in literature was calculated in two different methods: 1. Stimulation of protein synthesis in rat L6 myoblasts ED50 was found to be less than 30 ng/ml. 2. Type 1 IGF receptor binding assay ED50 was found to be less than 10 ng/ml.
Sequence GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA.
Modifications Disulfide bonds between Cys6-Cys48, Cys18-Cys61, Cys47-Cys52.
Structure
Molecular formula C336H522N94O99S7.
Activity IGF-I is a pleiotropic factor involved in multiple processes, so its actions are different depending on its concentration, the cell type, and the developmental stage of the animal1. IGF-I promotes proliferation of neural cells by interacting with the IGF-IR which may activate the PI3K/Akt or the MAP kinase pathways1.
Evidence indicates that IGF-I promotes cell survival by inhibiting apoptosis both in vivo and in vitro. IGF-I is also involved in the regulation of the migration of certain cell types1.
Accession number P08025.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Sterile water at a concentration of at least 1 µg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
Our bioassay
  • Alomone Labs Recombinant rat IGF-I protein promotes survival of PC12 cells.
    Alomone Labs Recombinant rat IGF-I protein promotes survival of PC12 cells.
    Dose-response curve of Recombinant rat IGF-I protein (#I-200) facilitation of survival of serum-deprived PC12 cells. Cell viability was determined by the XTT method and normalized to serum-supplemented control. EC50 was calculated at 12.5 ng/ml.
Scientific background

Insulin-like growth factor-I (IGF-I) belongs to the insulin family which is divided in two groups of peptides: 1- insulin and IGFs and 2- relaxin and insulin-like hormones. The structure of mature IGF-I is composed of a single polypeptide chain of 70 amino acids with 57 amino acids being identical across different organisms1,2.

IGF-I is a pleiotropic factor responsible for the regulation of several cellular processes depending on its concentration, cell type and the developmental stage of the organism.

IGF-I binds to IGF-I receptor and triggers the auto phosphorylation of the receptor and the activation of the insulin receptor substrates1.

In the embryonic brain IGF-I expression is relatively high and drops sharply in the adult brain except in the hippocampus and the subventricular zone-olfactory bulb. In adults IGF-I is mainly synthesized in the liver though a process regulated by the growth hormone (GH). IGF-I can cross the blood-brain-barrier by binding to the IGF-I receptor present on endothelial cells and is later picked up by astrocytes to be transferred to neurons or directly by neurons1,2.

Studies show that IGF-I influences neural stem cell proliferation and differentiation into neurons and glia as well as neuronal maturation including synapse formation. IGF-I also promotes adult neurogenesis by regulating neural stem cell number and differentiation1.

Target IGF receptor
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

  1. Recombinant human FGF-b protein (#F-170)
  2. Recombinant human EGF protein (#E-100)
  3. Recombinant rat CNTF protein (#C-245)
  4. Recombinant human CNTF protein (#C-240)
  5. Recombinant human GDNF protein (#G-240)
  6. Recombinant human BDNF protein (#B-250)
  7. Native mouse NGF 2.5S protein (>95%) (#N-100)
  8. Native mouse NGF 2.5S protein (99%) (#N-240)
  9. Recombinant human beta-NGF protein (#N-245)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 10 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order