Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Renal Membrane Proteins › Antibodies

Certificate of Analysis

Renal K+ Channel Antibody Explorer Kit

A Screening Package of Renal K+ Channel Antibodies Economically Priced

Back to product page
Cat #: AK-635
Size: 22 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KCNJ1 (Kir1.1) Antibody Cat #: APC-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1 (Accession P35560). Intracellular, C-terminus.
Homology
Mouse - identical; human - 45/50 amino acid residues identical.

KCNJ1/Kir1.1 Blocking Peptide Cat #: BLP-PC001

Size: 0.12 mg

Anti-Kir4.1 (KCNJ10) (extracellular) Antibody Cat #: APC-165

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)HGDLLELGPPANHT, corresponding to amino acid residues 93-106 of rat Kir4.1 (Accession P49655). Extracellular loop.
Homology
Mouse - identical; human - 13/14 amino acid residues identical.

Kir4.1/KCNJ10 (extracellular) Blocking Peptide Cat #: BLP-PC165

Size: 40 µg

Anti-Kir4.1 (KCNJ10) Antibody Cat #: APC-035

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)KLEE SLREQ AEKEG SALSV R, corresponding to amino acid residues 356-375 of rat Kir4.1 (Accession P49655). Intracellular, C-terminus.
Homology
Human, mouse - identical.

Kir4.1/KCNJ10 Blocking Peptide Cat #: BLP-PC035

Size: 40 µg

Guinea pig Anti-Kir4.1 (KCNJ10) Antibody Cat #: APC-035-GP (formerly AGP-012)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KLEESLREQAEKEGSALSVR, corresponding to amino acid residues 356-375 of rat Kir4.1 (Accession P49655). Intracellular, C-terminus.
Homology
Human, mouse - identical.

Kir4.1/KCNJ10 Blocking Peptide Cat #: BLP-PC035

Size: 40 µg

Anti-KCNJ15 (Kir4.2) Antibody Cat #: APC-058

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EKQKLEEQYRQEDQRERELR, corresponding to amino acid residues 347-366 of mouse KCNJ15 (Accession O88932). Intracellular, C-terminal part.
Homology
Guinea pig - 19/20 amino acid residues identical; human - 18/20 amino acid residues identical.

KCNJ15/Kir4.2 Blocking Peptide Cat #: BLP-PC058

Size: 40 µg

Anti-Kir5.1 Antibody Cat #: APC-123

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide HDVLEVKRKYYKVNC, corresponding to amino acid residues 311-325 of rat KCNJ16 (Accession P52191). Intracellular, C-terminal.
Homology
Mouse - identical; human 14/15 amino acid residues-identical.

Kir5.1 Blocking Peptide Cat #: BLP-PC123

Size: 40 µg

Anti-Kir7.1 (extracellular) Antibody Cat #: APC-125

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IFC, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EMNGDLEIDHDVPPE, corresponding to amino acid residues 80-94 of rat KCNJ13 (Accession O70617). Extracellular loop.
Homology
Mouse - identical; human - 13/15 amino acid residues identical.

Kir7.1 (extracellular) Blocking Peptide Cat #: BLP-PC125

Size: 40 µg

Anti-KV1.8 Antibody Cat #: APC-157

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)KDPETLLPTNDIHR, corresponding to amino acid residues 187-200 of human KV1.8 (Accession Q16322). Intracellular, N-terminus.
Homology
Rat, mouse  - 13/14 amino acid residues identical.

Kv1.8 Blocking Peptide Cat #: BLP-PC157

Size: 40 µg

Anti-KV4.1 (KCND1) Antibody Cat #: APC-119

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KRRAIRLANSTAS, corresponding to amino acid residues 538-550 of human KCND1 (Accession Q9NSA2). Intracellular, C-terminal domain.
Homology
Mouse, rat - 12/13 amino acid residues identical.

Kv4.1/KCND1 Blocking Peptide Cat #: BLP-PC119

Size: 40 µg

Anti-KCNK12 (THIK-2) (extracellular) Antibody Cat #: APC-169

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)ESPGEAEARARWG, corresponding to amino acid residues 61-73 of rat KCNK12 (Accession Q9ERS1). 1st extracellular loop.
Homology
Mouse, human – identical.

KCNK12/THIK-2 (extracellular) Blocking Peptide Cat #: BLP-PC169

Size: 40 µg

Anti-KCNQ1 (extracellular) Antibody Cat #: APC-168

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, LCI, WB Reactivity: H, M, R
Immunogen
Peptide(C)EKDAVNESGRIEFG, corresponding to amino acid residues 284-297 of rat KCNQ1 (Accession Q9Z0N7). 3rd extracellular loop.
Homology
Mouse – identical; human – 13/14 amino acid residues identical.

KCNQ1 (extracellular) Blocking Peptide Cat #: BLP-PC168

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top