Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Antibodies to KV Channels

Certificate of Analysis

Shaker (KV1) Channel Antibody Explorer Kit

A Screening Package of Shaker (KV1) Channel Antibodies Economically Priced

Back to product page
Cat #: AK-219
Size: 32 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.1 (KCNA1) Antibody Cat #: APC-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1 (Accession P16388). Intracellular, C-terminus.
Homology
Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical.

Kv1.1/KCNA1 Blocking Peptide Cat #: BLP-PC009

Size: 0.12 mg

Anti-KV1.1 (KCNA1) (extracellular) Antibody Cat #: APC-161

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)KDDKDFTGTIHRID, corresponding to amino acid residues 193-206 of rat KV1.1 (Accession P10499). 1st  extracellular loop.
Homology
Mouse - identical; human - 13/14 amino acid residues identical.

Kv1.1/KCNA1 (extracellular) Blocking Peptide Cat #: BLP-PC161

Size: 40 µg

Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Homology
Mouse, dog, human, - identical.

Kv1.2/KCNA2 Blocking Peptide Cat #: BLP-PC010

Size: 0.12 mg

Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Homology
Mouse - identical; human - 12/13 amino acid residues identical.

Kv1.2/KCNA2 (extracellular) Blocking Peptide Cat #: BLP-PC162

Size: 40 µg

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Homology
Rat, rabbit, mouse - identical.

Kv1.3/KCNA3 Blocking Peptide Cat #: BLP-PC002

Size: 0.12 mg

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Kv1.3/KCNA3 (extracellular) Blocking Peptide Cat #: BLP-PC101

Size: 40 µg

Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101-GP (formerly AGP-005)

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). 1st extracellular loop.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Kv1.3/KCNA3 (extracellular) Blocking Peptide Cat #: BLP-PC101

Size: 40 µg

Anti-KV1.4 Antibody Cat #: APC-007

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
Homology
Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.

Kv1.4 Blocking Peptide Cat #: BLP-PC007

Size: 0.12 mg

Anti-KV1.4 (extracellular) Antibody Cat #: APC-167

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)GHSRLLNDTSAPHLE, corresponding to amino acid residues 348 - 362 of rat KV1.4 (Accession P15385). 1st extracellular loop.
Homology
Mouse – identical; human – 13/15 amino acid residues identical.

Kv1.4 (extracellular) Blocking Peptide Cat #: BLP-PC167

Size: 40 µg

Anti-KV1.5 (KCNA5) Antibody Cat #: APC-004

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HRETDHEEQAALKEEQGIQRRESGLDTGGQRKVSCSKASFHKTGGPLEST DSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTS RETDL, corresponding to amino acid residues 513-602 of mouse KV1.5 (Accession Q61762). Intracellular, C-terminus.
Homology
Rat - 86/90 amino acid residues identical; rabbit - 71/90 amino acid residues identical; human - 70/90 amino acid residues identical; bovine, dog - 66/90 amino acid residues identical.

Kv1.5/KCNA5 Blocking Peptide Cat #: BLP-PC004

Size: 0.12 mg

Anti-KV1.5 (KCNA5) (extracellular) Antibody Cat #: APC-150

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, LCI, WB Reactivity: H, R
Immunogen
Peptide (C)DERELLRHPPVP(K), corresponding to amino acid residues 268-279 of rat KV1.5 (Accession P19024). 1st extracellular loop.
Homology
Rat - 12/13 amino acid residues identical; human - 11/13 amino acid residues identical; mouse - 9/13 amino acid residues identical.

Kv1.5/KCNA5 (extracellular) Blocking Peptide Cat #: BLP-PC150

Size: 40 µg

Anti-KV1.6 (KCNA6) Antibody Cat #: APC-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat KV1.6 (Accession P17659). Intracellular, C-terminus.
Homology
Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical.

Kv1.6/KCNA6 Blocking Peptide Cat #: BLP-PC003

Size: 0.12 mg

Anti-Mouse KV1.7 (KCNA7) Antibody Cat #: APC-063

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M
Immunogen
Peptide TTRKAQEIHGKAPG(C), corresponding to amino acid residues 2-15 of mouse KV1.7 (Accession Q17ST2). Intracellular, N-terminus.
Homology
Mouse only.

Mouse Kv1.7/KCNA7 Blocking Peptide Cat #: BLP-PC063

Size: 40 µg

Anti-KV1.8 Antibody Cat #: APC-157

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)KDPETLLPTNDIHR, corresponding to amino acid residues 187-200 of human KV1.8 (Accession Q16322). Intracellular, N-terminus.
Homology
Rat, mouse  - 13/14 amino acid residues identical.

Kv1.8 Blocking Peptide Cat #: BLP-PC157

Size: 40 µg

Anti-KVβ1 Antibody Cat #: APC-127

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)TPQHHISLKESTAK, corresponding to amino acid residues 54-67 of rat KCNAB1 (Accession P63144). N-terminus.
Homology
Mouse, human - identical.

Kvβ1 Blocking Peptide Cat #: BLP-PC127

Size: 40 µg

Anti-KVβ2 Antibody Cat #: APC-117

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide SPGMIYSTRYGSPKR(C), corresponding to amino acid residues 20-34 of rat KCNAB2 (Accession P62483). N-terminal part.
Homology
Mouse, human, rabbit - identical.

Kvβ2 Blocking Peptide Cat #: BLP-PC117

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A Guinea pig polyclonal antibody (#APC-101-GP) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.
For research purposes only, not for human use

Related Products

  1. Charybdotoxin (#STC-325)
  2. α-Dendrotoxin (#D-350)
  3. Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR)
  4. Noxiustoxin (#STN-340)
  5. Hemitoxin (#STH-500)
  6. Tityustoxin-Kα (#STT-360)
  7. KV1.2 (KCNA2) Channel Antibody and Membrane Fractions Kit (#LK-101)
  8. Shaker (KV1) Channel Blocker Explorer Kit (#EK-107)
  9. Shaker (KV)-Related Channel Antibody Explorer Kit (#AK-220)
  10. KV1.2 (KCNA2) Channel Basic Research Pack (#ESB-500)
  11. KV1.2 (KCNA2) Channel Premium Research Pack (#ESP-500)
  12. KV1.2 (KCNA2) Channel Deluxe Research Pack (#ESD-500)
  13. KV1.3 (KCNA3) Channel Basic Research Pack (#ESB-501)
  14. KV1.3 (KCNA3) Channel Premium Research Pack (#ESP-501)
  15. KV1.3 (KCNA3) Channel Deluxe Research Pack (#ESD-501)

Resources

  • KV1.3 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • KV1.3 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top