Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

SNX-482

ω-Theraphotoxin-Hg1a, ω-TRTX-Hg1a, SNX 482

A Blocker of CaV2.3 and KV4.3 Channels

Back to product page SDS

Overview

Cat #: RTS-500
Alternative Name ω-Theraphotoxin-Hg1a, ω-TRTX-Hg1a, SNX 482
Lyophilized Powder yes
Origin Recombinant, E. coli
MW: 4495 Da
Purity: >98% (HPLC)
Effective concentration 10-100 nM.
Sequence GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD.
Modifications Disulfide bonds between Cys7-Cys21, Cys14-Cys26, and Cys20-Cys33.
Structure
Molecular formula C192H274N52O60S7.
CAS No.: 203460-30-4
Activity SNX-482 blocks R-type (CaV2.3) and P/Q-type (CaV2.1) voltage-gated Ca2+ channels1. It also blocks A-type K+ channels with an IC50 < 3 nM2.
References-Activity
  1. Bourinet, E. et al. (2001) Biophys. J. 81, 79.
  2. Kimm, T. and Bean, B.P. (2014) J. Neurosci. 34, 9182.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
  • Alomone Labs SNX-482 inhibits CaV2.3 channels heterologously expressed in Xenopus oocytes.
    Alomone Labs SNX-482 inhibits CaV2.3 channels heterologously expressed in Xenopus oocytes.
    CaV2.3 channel subunits co-expressed in Xenopus oocytes. Using TEVC, membrane potential was held at -100 mV. Ba2+ (10 mM) currents via CaV2.3 channels were elicited by 40 ms long voltage ramps from -100 to +60 mV, delivered every 10 seconds. Left: Representative current traces before and following the application of 100, 200 and 400 nM SNX-482 (#RTS-500), as indicated. Right: Dose-response for SNX-482 (n = 2-6).
Scientific background

SNX-482 is a peptidyl toxin originally isolated from venom of the spider Hysterocrates gigas. Native SNX-482 blocks specifically CaV2.3 (α1E, R-type) channels1 in a voltage-dependent manner. The block is reversible only upon application of strong voltage to facilitate unbinding.2 SNX-482 inhibits human CaV2.3 channels stably expressed in a mammalian cell line. An IC50 of 15-30 nM was obtained for block of CaV2.3 channel, using either patch clamp electrophysiology or K+-evoked Ca2+ flux. At low nanomolar concentrations, SNX-482 also blocked a native R-type Ca2+ current in rat neurohypophyseal nerve terminals, but concentrations of 200-500 nM had no effect on R-type Ca2+ currents in several types of rat central neurons.1 SNX-482 was also used to demonstrate the contribution of CaV2.3 channels to transmitter release.3 Recently it was shown that higher concentrations of SNX-482 also block CaV2.1 channels in chromaffin cells.4

SNX-482 was found to be the most potent blocker to date for KV4.3 channel with IC50 < 3 nM5.

Target CaV2.3, CaV2.1, KV4.2, KV4.3 channels
Peptide Content: 100%
Lyophilized Powder
Image & Title SNX-482

Alomone Labs Nifedipine and SNX-482 block L-type and R-type CaV channels respectively in rat pancreatic INS-1 832/13 β-cells.Representative CaV currents from INS-1 832/13 cells before and after treatment with Nifedipine (#N-120), a general L-type CaV channel blocker and SNX-482 (#RTS-500), a CaV2.3 channel blocker. 52% of the currents were blocked by Nifedipine (n = 8; p < 0.05) while 31% (n = 10; p < 0.001) of currents were blocked by SNX-482. Cells were held at −70 mV for 2 min after formation of whole-cell mode, and currents elicited by stepped 300 or 500 millisecond depolarizations in 10 mV increments.Adapted from Xie, L. et al. (2016) PLoS ONE 11, e0147862. with permission of PLoS.
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-CaV2.3 (CACNA1E) Antibody (#ACC-006)
  2. Anti-CACNA1A (CaV2.1) Antibody (#ACC-001)
  3. Anti-CaVpan α1 Antibody (#ACC-004)
  4. Anti-KV4.3 Antibody (#APC-017)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. PLTX-II (#P-510)
  2. AmmTx3 Toxin (#STA-305)
  3. Guangxitoxin-1E (#STG-200)
  4. Heteropodatoxin-2 (#STH-340)
  5. Hm1a Toxin (#STH-601)
  6. Jingzhaotoxin-V (#STJ-050)
  7. Pandinotoxin Kα (#STP-500)
  8. Phrixotoxin-1 (#STP-700)
  9. Phrixotoxin-2 (#STP-710)

Explorer kits & Research packs

Explorer kits
  1. Classical Ion Channel Blockers for Pain Research Explorer Kit (#EK-355)
  2. CaV2 Channel Blocker Explorer Kit (#EK-110)
  3. CaV Channel Blockers for Pain Research Explorer Kit (#EK-385)
  4. Non-L-Type CaV Channel Antibody Explorer Kit (#AK-216)
  5. KV4 Channel Blocker Explorer Kit (#EK-130)
  6. Shaker (KV)-Related Channel Blocker Explorer Kit (#EK-108)
  7. Shaker (KV)-Related Channel Antibody Explorer Kit (#AK-220)
Research packs
  1. KV4 Channel Basic Research Pack (#ESB-502)
  2. KV4 Channel Premium Research Pack (#ESP-502)
  3. KV4 Channel Deluxe Research Pack (#ESD-502)

Resources

  • Voltage Dependent Ca2+ (CaV) Channels
  • KV4 Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Voltage Dependent Ca2+ (CaV) Channels

  • KV4 Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order